Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9DVK2

Protein Details
Accession E9DVK2   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
3-49SAKKHVPIVKKRTTRFNRHQSDRFKCLSASWRKPKGIDNRVRRRFRGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, mito_nucl 12.833, nucl 7, cyto_nucl 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG maw:MAC_01650  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHVPIVKKRTTRFNRHQSDRFKCLSASWRKPKGIDNRVRRRFRGTMAMPSIGFGSNKKTRYMMPSGHKSFLVNNVKDVELLMMHNRTYAAEIASAVSSRKRIDIIARAKQLGVKVTNARAKVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.8
3 0.81
4 0.81
5 0.82
6 0.82
7 0.82
8 0.86
9 0.86
10 0.84
11 0.8
12 0.72
13 0.63
14 0.53
15 0.47
16 0.49
17 0.49
18 0.51
19 0.54
20 0.59
21 0.59
22 0.61
23 0.65
24 0.66
25 0.66
26 0.66
27 0.67
28 0.7
29 0.78
30 0.81
31 0.75
32 0.72
33 0.64
34 0.58
35 0.56
36 0.48
37 0.46
38 0.43
39 0.43
40 0.35
41 0.32
42 0.3
43 0.21
44 0.18
45 0.11
46 0.14
47 0.18
48 0.2
49 0.2
50 0.2
51 0.21
52 0.26
53 0.3
54 0.3
55 0.31
56 0.39
57 0.41
58 0.41
59 0.4
60 0.35
61 0.32
62 0.35
63 0.37
64 0.28
65 0.26
66 0.27
67 0.27
68 0.26
69 0.25
70 0.16
71 0.08
72 0.09
73 0.1
74 0.09
75 0.09
76 0.1
77 0.1
78 0.09
79 0.1
80 0.1
81 0.08
82 0.08
83 0.08
84 0.09
85 0.09
86 0.09
87 0.08
88 0.09
89 0.11
90 0.12
91 0.13
92 0.13
93 0.14
94 0.2
95 0.29
96 0.36
97 0.42
98 0.46
99 0.45
100 0.45
101 0.45
102 0.42
103 0.38
104 0.32
105 0.29
106 0.3
107 0.37
108 0.42
109 0.41
110 0.41
111 0.36