Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3KZM5

Protein Details
Accession A0A0C3KZM5   
Localization Confidence Low
Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
13-38ISFHVTPKVHRSPRQRKHPTAPPGYPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto 6.5, cyto_nucl 6, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MLKTVHAAQGHRISFHVTPKVHRSPRQRKHPTAPPGYPVPMYYPARTSGCPGGPANCLSLAVSIVGLGFTVNKTKFGPIRTCYRPEISFCRHSVSPDHGPTDPRLITDPLIYVCAHKYGYPVKYTGCVRGAAKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.36
3 0.37
4 0.3
5 0.35
6 0.42
7 0.52
8 0.55
9 0.6
10 0.65
11 0.69
12 0.77
13 0.84
14 0.85
15 0.83
16 0.85
17 0.87
18 0.85
19 0.82
20 0.75
21 0.68
22 0.62
23 0.55
24 0.47
25 0.37
26 0.31
27 0.3
28 0.3
29 0.26
30 0.24
31 0.25
32 0.27
33 0.26
34 0.26
35 0.22
36 0.2
37 0.22
38 0.21
39 0.2
40 0.2
41 0.2
42 0.18
43 0.14
44 0.13
45 0.1
46 0.1
47 0.07
48 0.06
49 0.05
50 0.04
51 0.04
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.07
58 0.07
59 0.09
60 0.09
61 0.12
62 0.15
63 0.19
64 0.24
65 0.23
66 0.31
67 0.35
68 0.38
69 0.39
70 0.4
71 0.38
72 0.36
73 0.41
74 0.39
75 0.4
76 0.37
77 0.39
78 0.36
79 0.35
80 0.35
81 0.34
82 0.35
83 0.33
84 0.35
85 0.32
86 0.33
87 0.33
88 0.36
89 0.29
90 0.23
91 0.23
92 0.22
93 0.21
94 0.2
95 0.2
96 0.14
97 0.16
98 0.15
99 0.13
100 0.13
101 0.14
102 0.14
103 0.13
104 0.17
105 0.22
106 0.26
107 0.27
108 0.28
109 0.27
110 0.33
111 0.35
112 0.37
113 0.32
114 0.33