Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3PXK1

Protein Details
Accession A0A0C3PXK1    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
42-63TTLVQWKWTKWQRERNNKLAALHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 6.5, cyto_nucl 5.5, cyto 3.5, extr 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR024242  NCE101  
Gene Ontology GO:0016020  C:membrane  
GO:0009306  P:protein secretion  
Pfam View protein in Pfam  
PF11654  NCE101  
Amino Acid Sequences MTPPVLLSRGIDPLLGIFTGCLAYYLYETNPRTSLPADQRLTTLVQWKWTKWQRERNNKLAALEREAEATFSQVKGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.09
4 0.05
5 0.05
6 0.06
7 0.06
8 0.05
9 0.05
10 0.05
11 0.06
12 0.07
13 0.08
14 0.14
15 0.16
16 0.17
17 0.17
18 0.17
19 0.18
20 0.18
21 0.23
22 0.21
23 0.29
24 0.28
25 0.28
26 0.28
27 0.28
28 0.28
29 0.23
30 0.24
31 0.16
32 0.22
33 0.23
34 0.24
35 0.32
36 0.38
37 0.47
38 0.49
39 0.59
40 0.63
41 0.73
42 0.8
43 0.79
44 0.81
45 0.74
46 0.68
47 0.66
48 0.58
49 0.52
50 0.45
51 0.37
52 0.31
53 0.28
54 0.27
55 0.18
56 0.18
57 0.15