Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3P3E2

Protein Details
Accession A0A0C3P3E2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
3-25GGSAKCCTRSRSRKFQKSALFNFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, plas 6, cyto_mito 6, mito_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009653  Ksh1  
Gene Ontology GO:0000139  C:Golgi membrane  
Pfam View protein in Pfam  
PF06842  DUF1242  
Amino Acid Sequences MVGGSAKCCTRSRSRKFQKSALFNFQSLLRVILLMICTCTYVRAVAPRLIDRNKEGILGLFFMSARIGERLSPYVAMACVAMAVTMLVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.77
3 0.81
4 0.84
5 0.83
6 0.82
7 0.8
8 0.78
9 0.7
10 0.6
11 0.54
12 0.47
13 0.39
14 0.3
15 0.23
16 0.13
17 0.1
18 0.09
19 0.09
20 0.08
21 0.06
22 0.07
23 0.05
24 0.06
25 0.06
26 0.07
27 0.06
28 0.06
29 0.07
30 0.1
31 0.12
32 0.13
33 0.15
34 0.17
35 0.21
36 0.23
37 0.24
38 0.22
39 0.24
40 0.22
41 0.21
42 0.19
43 0.15
44 0.14
45 0.13
46 0.11
47 0.08
48 0.08
49 0.07
50 0.07
51 0.06
52 0.07
53 0.07
54 0.07
55 0.08
56 0.11
57 0.13
58 0.14
59 0.14
60 0.13
61 0.13
62 0.13
63 0.12
64 0.1
65 0.07
66 0.06
67 0.06
68 0.05
69 0.04