Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3KDU3

Protein Details
Accession A0A0C3KDU3    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
101-120SKDARKGKSKARSGPPEPRYBasic
NLS Segment(s)
PositionSequence
102-114KDARKGKSKARSG
Subcellular Location(s) nucl 18.5, cyto_nucl 14, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MSYTPNTENPGSDYFDNDFHADIDEPYDPSRPYFDRYASTPPRLSQPPVRSPGAVHTVSPAVSANSSHGGTCQPLHDSVASATRPYPYPVIHSVPSSQRASKDARKGKSKARSGPPEPRYDPTFRACNTPLLSQAGYRSPSPLPRAGPSAPAPSLAPASTSAPAVTPAAPSTGKWVAPEASIFLGYMRLLNDFERWESHGWRAGERHEHLRVLSKIFRSSEVIGKRVYDQVATAEGSFEAHTYEDIDKANSAILQETLKTQEAVVKIVHEDYGPSLISSFRAFLDRTPVDVVRLEDRAYLRTLTERRHGRSREKKPVSEGRYNMDPEEAERLAEMSNRGVAIAGRRLYRAKVESTSRPSQTRSHLSRSTDRPTTGSTFSLKPEVVPLEEPSSTLLRHQELYWQLPSSLYLSPPSANENLVGSFPSIGSIPSISSPATDVHALDIGHLTAQLAVATNSEIRSWVQQGLYPPSEDLRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.28
4 0.25
5 0.22
6 0.18
7 0.19
8 0.16
9 0.14
10 0.16
11 0.15
12 0.16
13 0.17
14 0.2
15 0.18
16 0.19
17 0.25
18 0.24
19 0.27
20 0.31
21 0.33
22 0.33
23 0.37
24 0.46
25 0.48
26 0.52
27 0.5
28 0.47
29 0.51
30 0.51
31 0.53
32 0.52
33 0.54
34 0.56
35 0.59
36 0.59
37 0.52
38 0.49
39 0.5
40 0.48
41 0.4
42 0.31
43 0.27
44 0.26
45 0.25
46 0.25
47 0.19
48 0.12
49 0.12
50 0.13
51 0.12
52 0.14
53 0.14
54 0.14
55 0.14
56 0.14
57 0.15
58 0.16
59 0.16
60 0.15
61 0.15
62 0.18
63 0.17
64 0.17
65 0.17
66 0.21
67 0.2
68 0.18
69 0.19
70 0.19
71 0.2
72 0.21
73 0.23
74 0.18
75 0.23
76 0.27
77 0.3
78 0.29
79 0.3
80 0.31
81 0.33
82 0.38
83 0.37
84 0.34
85 0.31
86 0.34
87 0.4
88 0.43
89 0.48
90 0.51
91 0.55
92 0.61
93 0.65
94 0.7
95 0.73
96 0.73
97 0.72
98 0.74
99 0.76
100 0.75
101 0.8
102 0.77
103 0.76
104 0.7
105 0.65
106 0.6
107 0.55
108 0.51
109 0.46
110 0.47
111 0.39
112 0.42
113 0.39
114 0.39
115 0.38
116 0.35
117 0.32
118 0.29
119 0.28
120 0.23
121 0.24
122 0.22
123 0.21
124 0.2
125 0.21
126 0.19
127 0.24
128 0.27
129 0.29
130 0.27
131 0.27
132 0.32
133 0.3
134 0.32
135 0.3
136 0.3
137 0.26
138 0.25
139 0.23
140 0.19
141 0.19
142 0.15
143 0.13
144 0.1
145 0.11
146 0.11
147 0.11
148 0.1
149 0.09
150 0.1
151 0.1
152 0.09
153 0.08
154 0.08
155 0.1
156 0.1
157 0.1
158 0.14
159 0.15
160 0.15
161 0.15
162 0.17
163 0.15
164 0.15
165 0.16
166 0.11
167 0.09
168 0.09
169 0.09
170 0.07
171 0.07
172 0.06
173 0.07
174 0.06
175 0.07
176 0.07
177 0.08
178 0.09
179 0.1
180 0.11
181 0.11
182 0.13
183 0.14
184 0.15
185 0.16
186 0.2
187 0.2
188 0.21
189 0.21
190 0.22
191 0.26
192 0.27
193 0.3
194 0.27
195 0.27
196 0.25
197 0.3
198 0.29
199 0.26
200 0.28
201 0.24
202 0.25
203 0.25
204 0.26
205 0.22
206 0.23
207 0.25
208 0.24
209 0.24
210 0.21
211 0.21
212 0.21
213 0.21
214 0.19
215 0.13
216 0.11
217 0.1
218 0.11
219 0.11
220 0.09
221 0.07
222 0.07
223 0.07
224 0.07
225 0.06
226 0.05
227 0.04
228 0.04
229 0.06
230 0.07
231 0.08
232 0.08
233 0.08
234 0.08
235 0.08
236 0.08
237 0.06
238 0.06
239 0.05
240 0.06
241 0.06
242 0.06
243 0.07
244 0.09
245 0.09
246 0.09
247 0.08
248 0.11
249 0.11
250 0.13
251 0.12
252 0.1
253 0.1
254 0.11
255 0.11
256 0.07
257 0.07
258 0.06
259 0.08
260 0.07
261 0.06
262 0.06
263 0.06
264 0.07
265 0.07
266 0.08
267 0.07
268 0.09
269 0.09
270 0.09
271 0.17
272 0.17
273 0.18
274 0.2
275 0.19
276 0.19
277 0.2
278 0.21
279 0.15
280 0.16
281 0.15
282 0.15
283 0.16
284 0.16
285 0.16
286 0.15
287 0.12
288 0.18
289 0.21
290 0.22
291 0.29
292 0.34
293 0.37
294 0.46
295 0.51
296 0.55
297 0.63
298 0.7
299 0.73
300 0.73
301 0.71
302 0.7
303 0.75
304 0.71
305 0.69
306 0.61
307 0.54
308 0.53
309 0.51
310 0.43
311 0.34
312 0.27
313 0.2
314 0.24
315 0.19
316 0.13
317 0.12
318 0.12
319 0.11
320 0.13
321 0.13
322 0.08
323 0.09
324 0.09
325 0.09
326 0.09
327 0.09
328 0.1
329 0.15
330 0.17
331 0.17
332 0.19
333 0.21
334 0.22
335 0.26
336 0.26
337 0.25
338 0.28
339 0.33
340 0.38
341 0.45
342 0.5
343 0.49
344 0.49
345 0.48
346 0.48
347 0.5
348 0.52
349 0.5
350 0.51
351 0.52
352 0.55
353 0.6
354 0.62
355 0.61
356 0.56
357 0.52
358 0.46
359 0.44
360 0.43
361 0.37
362 0.33
363 0.29
364 0.26
365 0.27
366 0.29
367 0.25
368 0.21
369 0.23
370 0.22
371 0.2
372 0.2
373 0.21
374 0.21
375 0.21
376 0.21
377 0.19
378 0.19
379 0.17
380 0.18
381 0.19
382 0.18
383 0.19
384 0.19
385 0.24
386 0.27
387 0.31
388 0.31
389 0.29
390 0.27
391 0.26
392 0.26
393 0.22
394 0.19
395 0.16
396 0.15
397 0.16
398 0.17
399 0.17
400 0.21
401 0.19
402 0.18
403 0.18
404 0.17
405 0.16
406 0.16
407 0.15
408 0.12
409 0.11
410 0.1
411 0.1
412 0.09
413 0.08
414 0.09
415 0.08
416 0.09
417 0.09
418 0.11
419 0.1
420 0.1
421 0.12
422 0.12
423 0.13
424 0.14
425 0.13
426 0.13
427 0.16
428 0.15
429 0.15
430 0.15
431 0.12
432 0.12
433 0.11
434 0.1
435 0.07
436 0.08
437 0.07
438 0.07
439 0.07
440 0.07
441 0.09
442 0.11
443 0.11
444 0.11
445 0.12
446 0.13
447 0.17
448 0.19
449 0.21
450 0.21
451 0.23
452 0.28
453 0.35
454 0.36
455 0.33
456 0.32