Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3PF17

Protein Details
Accession A0A0C3PF17    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
39-64ISYLSRIPRPRLKRPRKPCLAVRCVKHydrophilic
NLS Segment(s)
PositionSequence
46-55PRPRLKRPRK
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MPGKDRPGCRILNKYTGPTLRAYPNMDSSPLPPAQPRVISYLSRIPRPRLKRPRKPCLAVRCVKHGMQNVDITEMQDAIDSSTTGGTASPLPDVPPRSAEPTAPPTTPTVWSEISVFRNISRTDPQASGNLRECLPRGDPDGRRYAMGYQDQPVMAIKRSITTQNSYVEDVTPDGCPAFEVVTTSSQCEEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.58
3 0.55
4 0.5
5 0.43
6 0.42
7 0.38
8 0.39
9 0.38
10 0.34
11 0.36
12 0.35
13 0.34
14 0.31
15 0.27
16 0.29
17 0.26
18 0.24
19 0.2
20 0.23
21 0.25
22 0.26
23 0.26
24 0.26
25 0.28
26 0.28
27 0.3
28 0.34
29 0.33
30 0.38
31 0.4
32 0.41
33 0.47
34 0.54
35 0.62
36 0.65
37 0.73
38 0.76
39 0.83
40 0.88
41 0.88
42 0.87
43 0.85
44 0.84
45 0.83
46 0.78
47 0.71
48 0.68
49 0.62
50 0.56
51 0.52
52 0.47
53 0.41
54 0.37
55 0.36
56 0.29
57 0.28
58 0.26
59 0.22
60 0.16
61 0.13
62 0.1
63 0.08
64 0.07
65 0.05
66 0.05
67 0.05
68 0.05
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.05
75 0.05
76 0.06
77 0.06
78 0.07
79 0.09
80 0.11
81 0.11
82 0.13
83 0.14
84 0.18
85 0.18
86 0.18
87 0.18
88 0.23
89 0.25
90 0.22
91 0.22
92 0.19
93 0.2
94 0.22
95 0.19
96 0.16
97 0.14
98 0.15
99 0.15
100 0.17
101 0.17
102 0.17
103 0.17
104 0.14
105 0.18
106 0.18
107 0.19
108 0.2
109 0.21
110 0.22
111 0.23
112 0.24
113 0.26
114 0.27
115 0.28
116 0.28
117 0.28
118 0.25
119 0.25
120 0.24
121 0.22
122 0.22
123 0.19
124 0.21
125 0.27
126 0.31
127 0.34
128 0.4
129 0.38
130 0.36
131 0.36
132 0.33
133 0.31
134 0.32
135 0.29
136 0.25
137 0.26
138 0.25
139 0.25
140 0.25
141 0.21
142 0.17
143 0.17
144 0.15
145 0.15
146 0.17
147 0.22
148 0.23
149 0.26
150 0.28
151 0.32
152 0.34
153 0.34
154 0.33
155 0.28
156 0.26
157 0.22
158 0.2
159 0.15
160 0.13
161 0.11
162 0.1
163 0.1
164 0.09
165 0.09
166 0.08
167 0.09
168 0.11
169 0.16
170 0.17
171 0.19