Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3NY13

Protein Details
Accession A0A0C3NY13    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
49-73GVDSTARKPKPKPRIRSNGWFPCTLHydrophilic
NLS Segment(s)
PositionSequence
55-62RKPKPKPR
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
Amino Acid Sequences MILELCAKDHPTGTSNAQEDNRWQNQSTSDWHNMTTAYPKPADNHANDGVDSTARKPKPKPRIRSNGWFPCTLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.29
4 0.29
5 0.28
6 0.3
7 0.35
8 0.36
9 0.32
10 0.32
11 0.29
12 0.3
13 0.31
14 0.31
15 0.29
16 0.28
17 0.27
18 0.26
19 0.25
20 0.23
21 0.21
22 0.21
23 0.17
24 0.14
25 0.15
26 0.15
27 0.16
28 0.21
29 0.25
30 0.22
31 0.26
32 0.26
33 0.26
34 0.25
35 0.24
36 0.2
37 0.16
38 0.16
39 0.13
40 0.19
41 0.21
42 0.26
43 0.32
44 0.42
45 0.52
46 0.61
47 0.69
48 0.72
49 0.8
50 0.84
51 0.87
52 0.88
53 0.88
54 0.81