Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3PYU1

Protein Details
Accession A0A0C3PYU1   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MDHPTSEPVKKRRKTTKKWDNFTPSFHydrophilic
NLS Segment(s)
PositionSequence
11-14KRRK
Subcellular Location(s) nucl 15, mito_nucl 11.666, cyto_nucl 10.666, mito 6, cyto 4
Family & Domain DBs
Amino Acid Sequences MDHPTSEPVKKRRKTTKKWDNFTPSFDPNPSKLEDRPPHSNKATPTIPFKTMINDAWLTAHPSQQVVDGMDWLKGFYSRAKEGELSDGDTKYLAELAAELANDNDDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.87
3 0.89
4 0.89
5 0.89
6 0.89
7 0.88
8 0.8
9 0.76
10 0.7
11 0.63
12 0.55
13 0.51
14 0.45
15 0.37
16 0.36
17 0.32
18 0.29
19 0.27
20 0.34
21 0.37
22 0.4
23 0.48
24 0.5
25 0.53
26 0.52
27 0.54
28 0.45
29 0.46
30 0.42
31 0.34
32 0.37
33 0.33
34 0.32
35 0.29
36 0.28
37 0.24
38 0.23
39 0.21
40 0.17
41 0.14
42 0.13
43 0.13
44 0.13
45 0.14
46 0.12
47 0.13
48 0.11
49 0.11
50 0.11
51 0.11
52 0.12
53 0.09
54 0.09
55 0.09
56 0.09
57 0.1
58 0.1
59 0.09
60 0.08
61 0.07
62 0.08
63 0.11
64 0.16
65 0.18
66 0.19
67 0.21
68 0.22
69 0.23
70 0.28
71 0.25
72 0.24
73 0.24
74 0.23
75 0.21
76 0.2
77 0.19
78 0.13
79 0.13
80 0.08
81 0.05
82 0.05
83 0.07
84 0.08
85 0.08
86 0.08
87 0.08