Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9DW87

Protein Details
Accession E9DW87    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
115-142MPPNVDPSKKPPSRKKRKIPRSGTPATSHydrophilic
NLS Segment(s)
PositionSequence
123-136KKPPSRKKRKIPRS
Subcellular Location(s) plas 12, E.R. 5, mito 4, extr 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004299  MBOAT_fam  
Gene Ontology GO:0016020  C:membrane  
KEGG maw:MAC_01885  -  
Pfam View protein in Pfam  
PF03062  MBOAT  
Amino Acid Sequences MKNSHYMPWVGFMFVMGHMSISHIRRQAANSPSTVDITGAQMVLVMKLSAFCWNVADGQLPDEILSDFQKDRALCELPSILDYAGYTLFFPSLFAGPAFDYVDYRRWIDTSMFDMPPNVDPSKKPPSRKKRKIPRSGTPATSKAFLGLFWISLFVVLSARYGHEQLLVDTYMHHDLWRRIWIMYMVNLVARLKYYGVWTLTEGSCILAGLGYNGVDPITGKVFWNRLQNVDPWTVETAQNPRGYLAGWNKNTNSWLRNYVYLRVTPRGKKPGFRASMMTFVTSAFWHGFYPGYYLTFVLASLIQTAAKNFRRLVRPFFLDAITGGPSPKKKYYDAASFIVTQLTFSFATTPFLVLTFADSIRAWSRVYFYGAAWTVIGLVFFASPGGAVLKAELEKRQGKASVKLVRSASTDSLTGKDPILGISKDPERDVTEAMAEIRAEVEARQKKTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.1
4 0.09
5 0.09
6 0.12
7 0.17
8 0.18
9 0.23
10 0.26
11 0.28
12 0.31
13 0.35
14 0.41
15 0.42
16 0.43
17 0.39
18 0.38
19 0.38
20 0.37
21 0.33
22 0.25
23 0.19
24 0.17
25 0.17
26 0.14
27 0.11
28 0.11
29 0.11
30 0.11
31 0.1
32 0.08
33 0.07
34 0.07
35 0.08
36 0.11
37 0.12
38 0.12
39 0.13
40 0.14
41 0.15
42 0.15
43 0.18
44 0.13
45 0.14
46 0.14
47 0.13
48 0.12
49 0.11
50 0.11
51 0.09
52 0.1
53 0.12
54 0.12
55 0.13
56 0.18
57 0.17
58 0.18
59 0.22
60 0.23
61 0.2
62 0.23
63 0.23
64 0.19
65 0.2
66 0.19
67 0.14
68 0.12
69 0.12
70 0.1
71 0.09
72 0.08
73 0.08
74 0.07
75 0.07
76 0.07
77 0.07
78 0.08
79 0.08
80 0.09
81 0.08
82 0.09
83 0.09
84 0.11
85 0.12
86 0.1
87 0.11
88 0.12
89 0.17
90 0.18
91 0.19
92 0.18
93 0.17
94 0.19
95 0.19
96 0.19
97 0.19
98 0.23
99 0.22
100 0.22
101 0.22
102 0.22
103 0.23
104 0.25
105 0.22
106 0.18
107 0.18
108 0.25
109 0.35
110 0.4
111 0.46
112 0.53
113 0.63
114 0.73
115 0.83
116 0.87
117 0.87
118 0.93
119 0.94
120 0.92
121 0.91
122 0.89
123 0.85
124 0.79
125 0.74
126 0.67
127 0.57
128 0.5
129 0.39
130 0.31
131 0.25
132 0.19
133 0.16
134 0.12
135 0.1
136 0.09
137 0.09
138 0.08
139 0.08
140 0.08
141 0.05
142 0.05
143 0.05
144 0.05
145 0.05
146 0.06
147 0.07
148 0.08
149 0.08
150 0.1
151 0.1
152 0.1
153 0.12
154 0.12
155 0.1
156 0.1
157 0.12
158 0.11
159 0.11
160 0.11
161 0.12
162 0.14
163 0.16
164 0.2
165 0.19
166 0.17
167 0.18
168 0.19
169 0.17
170 0.17
171 0.15
172 0.11
173 0.1
174 0.11
175 0.1
176 0.09
177 0.08
178 0.07
179 0.06
180 0.07
181 0.08
182 0.1
183 0.11
184 0.11
185 0.12
186 0.15
187 0.14
188 0.14
189 0.13
190 0.1
191 0.09
192 0.08
193 0.07
194 0.04
195 0.04
196 0.03
197 0.03
198 0.03
199 0.03
200 0.03
201 0.03
202 0.03
203 0.03
204 0.04
205 0.05
206 0.05
207 0.06
208 0.08
209 0.11
210 0.14
211 0.2
212 0.2
213 0.21
214 0.23
215 0.25
216 0.26
217 0.26
218 0.22
219 0.17
220 0.18
221 0.17
222 0.16
223 0.16
224 0.16
225 0.19
226 0.2
227 0.19
228 0.17
229 0.16
230 0.16
231 0.19
232 0.23
233 0.26
234 0.27
235 0.3
236 0.3
237 0.31
238 0.33
239 0.31
240 0.25
241 0.19
242 0.23
243 0.22
244 0.27
245 0.27
246 0.3
247 0.29
248 0.3
249 0.31
250 0.31
251 0.36
252 0.35
253 0.41
254 0.46
255 0.46
256 0.48
257 0.52
258 0.56
259 0.53
260 0.5
261 0.48
262 0.4
263 0.44
264 0.39
265 0.33
266 0.23
267 0.2
268 0.19
269 0.14
270 0.14
271 0.08
272 0.08
273 0.08
274 0.08
275 0.08
276 0.08
277 0.1
278 0.09
279 0.1
280 0.09
281 0.09
282 0.09
283 0.09
284 0.08
285 0.07
286 0.07
287 0.05
288 0.06
289 0.06
290 0.06
291 0.07
292 0.08
293 0.15
294 0.18
295 0.21
296 0.22
297 0.28
298 0.36
299 0.39
300 0.45
301 0.43
302 0.44
303 0.44
304 0.44
305 0.38
306 0.3
307 0.27
308 0.21
309 0.17
310 0.13
311 0.11
312 0.13
313 0.16
314 0.2
315 0.26
316 0.27
317 0.28
318 0.33
319 0.4
320 0.45
321 0.47
322 0.45
323 0.42
324 0.39
325 0.37
326 0.33
327 0.25
328 0.17
329 0.12
330 0.12
331 0.1
332 0.1
333 0.12
334 0.1
335 0.13
336 0.13
337 0.14
338 0.11
339 0.11
340 0.12
341 0.09
342 0.11
343 0.1
344 0.1
345 0.11
346 0.11
347 0.13
348 0.15
349 0.17
350 0.15
351 0.14
352 0.17
353 0.18
354 0.21
355 0.2
356 0.18
357 0.23
358 0.23
359 0.23
360 0.19
361 0.17
362 0.14
363 0.13
364 0.12
365 0.05
366 0.05
367 0.04
368 0.04
369 0.04
370 0.04
371 0.03
372 0.04
373 0.05
374 0.05
375 0.05
376 0.06
377 0.08
378 0.11
379 0.13
380 0.15
381 0.21
382 0.26
383 0.28
384 0.32
385 0.36
386 0.38
387 0.44
388 0.5
389 0.52
390 0.49
391 0.54
392 0.51
393 0.48
394 0.47
395 0.44
396 0.37
397 0.3
398 0.3
399 0.25
400 0.25
401 0.25
402 0.23
403 0.2
404 0.18
405 0.16
406 0.17
407 0.21
408 0.19
409 0.18
410 0.23
411 0.28
412 0.29
413 0.29
414 0.31
415 0.29
416 0.3
417 0.3
418 0.25
419 0.22
420 0.21
421 0.21
422 0.19
423 0.16
424 0.13
425 0.12
426 0.11
427 0.1
428 0.1
429 0.19
430 0.25