Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E9DVR0

Protein Details
Accession E9DVR0    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
46-66HLFVRRRRNKKLGKTGNKDGPBasic
NLS Segment(s)
PositionSequence
50-98RRRRNKKLGKTGNKDGPKATPTNSAWGKKKSKGSISGRFSEGPKPAEPP
Subcellular Location(s) nucl 10, mito 6, plas 5, cyto 3, golg 2, cyto_pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG maw:MAC_01708  -  
Amino Acid Sequences MPSQYSTAPPQKQLAPKNAGGSDQSTKFIIGFCVAIPCTLMIVGLHLFVRRRRNKKLGKTGNKDGPKATPTNSAWGKKKSKGSISGRFSEGPKPAEPPPAYKREKELLPTWL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.52
3 0.52
4 0.54
5 0.51
6 0.45
7 0.39
8 0.36
9 0.32
10 0.28
11 0.27
12 0.22
13 0.21
14 0.2
15 0.18
16 0.15
17 0.1
18 0.09
19 0.08
20 0.1
21 0.09
22 0.09
23 0.09
24 0.08
25 0.07
26 0.07
27 0.06
28 0.04
29 0.05
30 0.05
31 0.05
32 0.06
33 0.07
34 0.09
35 0.13
36 0.23
37 0.31
38 0.37
39 0.44
40 0.54
41 0.62
42 0.7
43 0.77
44 0.78
45 0.8
46 0.81
47 0.8
48 0.79
49 0.74
50 0.65
51 0.56
52 0.48
53 0.4
54 0.35
55 0.29
56 0.28
57 0.25
58 0.32
59 0.36
60 0.38
61 0.41
62 0.48
63 0.52
64 0.5
65 0.57
66 0.56
67 0.56
68 0.6
69 0.63
70 0.65
71 0.65
72 0.63
73 0.58
74 0.54
75 0.5
76 0.46
77 0.42
78 0.35
79 0.31
80 0.31
81 0.3
82 0.37
83 0.37
84 0.39
85 0.42
86 0.48
87 0.52
88 0.51
89 0.55
90 0.52
91 0.55
92 0.54