Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3N0H6

Protein Details
Accession A0A0C3N0H6    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
119-138ETMRAKAKERKRQKVAEQACHydrophilic
NLS Segment(s)
PositionSequence
126-129KERK
Subcellular Location(s) nucl 11, cyto_nucl 10.5, cyto 8, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
IPR000953  Chromo/chromo_shadow_dom  
IPR023780  Chromo_domain  
IPR023779  Chromodomain_CS  
Gene Ontology GO:1901363  F:heterocyclic compound binding  
GO:0097159  F:organic cyclic compound binding  
Pfam View protein in Pfam  
PF00385  Chromo  
PROSITE View protein in PROSITE  
PS00598  CHROMO_1  
PS50013  CHROMO_2  
CDD cd00024  CD_CSD  
Amino Acid Sequences MFHASKLTPFVKTKEYGPAQPPPPPELVGDENEWEVKAILKHKCACKVKSSSKEPSVTLQQKYHYLVKWLGYLHFQNSWESKDNLINAPEVLRDEGQVMIDWTQVSEDTIKYDTDNEEETMRAKAKERKRQKVAEQACWEEQAQLEAERVEREKAKGEEEEAKGEDEPMAEAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.43
3 0.43
4 0.45
5 0.5
6 0.48
7 0.51
8 0.51
9 0.45
10 0.43
11 0.37
12 0.33
13 0.3
14 0.29
15 0.27
16 0.25
17 0.23
18 0.21
19 0.21
20 0.19
21 0.14
22 0.12
23 0.11
24 0.12
25 0.18
26 0.21
27 0.27
28 0.33
29 0.37
30 0.47
31 0.52
32 0.52
33 0.54
34 0.59
35 0.63
36 0.67
37 0.69
38 0.68
39 0.66
40 0.67
41 0.59
42 0.54
43 0.54
44 0.51
45 0.47
46 0.41
47 0.37
48 0.37
49 0.39
50 0.39
51 0.3
52 0.27
53 0.25
54 0.24
55 0.24
56 0.22
57 0.19
58 0.18
59 0.18
60 0.16
61 0.17
62 0.16
63 0.16
64 0.17
65 0.19
66 0.19
67 0.19
68 0.19
69 0.18
70 0.19
71 0.18
72 0.17
73 0.14
74 0.12
75 0.11
76 0.1
77 0.09
78 0.08
79 0.07
80 0.06
81 0.07
82 0.07
83 0.07
84 0.07
85 0.07
86 0.06
87 0.06
88 0.06
89 0.05
90 0.05
91 0.05
92 0.05
93 0.06
94 0.06
95 0.07
96 0.08
97 0.09
98 0.09
99 0.1
100 0.11
101 0.11
102 0.13
103 0.12
104 0.12
105 0.12
106 0.13
107 0.14
108 0.15
109 0.14
110 0.18
111 0.26
112 0.35
113 0.46
114 0.55
115 0.63
116 0.7
117 0.77
118 0.8
119 0.82
120 0.8
121 0.79
122 0.74
123 0.69
124 0.61
125 0.55
126 0.47
127 0.37
128 0.31
129 0.22
130 0.18
131 0.13
132 0.13
133 0.11
134 0.12
135 0.14
136 0.15
137 0.18
138 0.19
139 0.2
140 0.27
141 0.28
142 0.31
143 0.3
144 0.33
145 0.38
146 0.37
147 0.4
148 0.34
149 0.34
150 0.3
151 0.29
152 0.25
153 0.17