Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E9DTW2

Protein Details
Accession E9DTW2    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MASSTTPRRRHYKDTPSTPVSPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010666  Znf_GRF  
Gene Ontology GO:0008270  F:zinc ion binding  
KEGG maw:MAC_01060  -  
Pfam View protein in Pfam  
PF06839  zf-GRF  
PROSITE View protein in PROSITE  
PS51999  ZF_GRF  
Amino Acid Sequences MASSTTPRRRHYKDTPSTPVSPSKAQELPSSQKKRLDGVWQDGLWWCNCDPRKKAVLREVKKDGPNKGRLFWTCEIHRRLSCNFFLWRDDAVVRESGSAPGSDADLVDNPAVPTRPKTPTFTQRPLESYGIQATPSCRRDRGLGGANKASKAAGSSPTSSQRTRETQALASLASPATPSSKRKRNPNDSWDEDDDEDEFTDLDSDLERQLAEITDKSVQMATLGLPSDDAFSTPSTNRRTTVIVGGLPTPSVSRTLFPASEAKRSKAVSFEEPTSSDTLTTPSKTPSSDSSFSLVCASSSPPDATTQDVTEKVMTLLSRQKIDPAVLQSVQGLLLMSARKTKGLSLGRDSARAALKEKDKKISQLQEKIRDLENQAAYNHKRMTNMKAQLIRLYEEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.84
3 0.8
4 0.77
5 0.72
6 0.69
7 0.63
8 0.58
9 0.5
10 0.47
11 0.44
12 0.42
13 0.44
14 0.44
15 0.48
16 0.53
17 0.59
18 0.57
19 0.59
20 0.6
21 0.57
22 0.55
23 0.56
24 0.52
25 0.52
26 0.54
27 0.48
28 0.48
29 0.46
30 0.44
31 0.34
32 0.3
33 0.22
34 0.24
35 0.3
36 0.36
37 0.38
38 0.43
39 0.52
40 0.55
41 0.63
42 0.64
43 0.7
44 0.69
45 0.74
46 0.74
47 0.72
48 0.73
49 0.71
50 0.7
51 0.69
52 0.71
53 0.65
54 0.61
55 0.61
56 0.57
57 0.58
58 0.53
59 0.51
60 0.48
61 0.54
62 0.54
63 0.53
64 0.53
65 0.5
66 0.5
67 0.48
68 0.44
69 0.4
70 0.4
71 0.36
72 0.36
73 0.34
74 0.3
75 0.27
76 0.25
77 0.22
78 0.19
79 0.18
80 0.16
81 0.15
82 0.15
83 0.14
84 0.14
85 0.12
86 0.11
87 0.1
88 0.1
89 0.08
90 0.08
91 0.07
92 0.08
93 0.09
94 0.08
95 0.09
96 0.08
97 0.1
98 0.11
99 0.11
100 0.13
101 0.18
102 0.24
103 0.26
104 0.32
105 0.38
106 0.47
107 0.55
108 0.6
109 0.59
110 0.56
111 0.56
112 0.55
113 0.5
114 0.4
115 0.33
116 0.28
117 0.24
118 0.21
119 0.19
120 0.17
121 0.22
122 0.25
123 0.26
124 0.24
125 0.25
126 0.28
127 0.3
128 0.33
129 0.35
130 0.35
131 0.37
132 0.41
133 0.41
134 0.38
135 0.35
136 0.28
137 0.19
138 0.16
139 0.14
140 0.13
141 0.14
142 0.16
143 0.19
144 0.25
145 0.29
146 0.29
147 0.29
148 0.3
149 0.32
150 0.33
151 0.33
152 0.29
153 0.27
154 0.28
155 0.26
156 0.21
157 0.16
158 0.14
159 0.11
160 0.08
161 0.07
162 0.06
163 0.08
164 0.11
165 0.17
166 0.24
167 0.33
168 0.38
169 0.49
170 0.59
171 0.66
172 0.72
173 0.75
174 0.75
175 0.72
176 0.73
177 0.64
178 0.56
179 0.45
180 0.37
181 0.28
182 0.2
183 0.15
184 0.09
185 0.07
186 0.05
187 0.05
188 0.04
189 0.04
190 0.04
191 0.05
192 0.05
193 0.05
194 0.05
195 0.05
196 0.05
197 0.05
198 0.06
199 0.06
200 0.07
201 0.09
202 0.09
203 0.09
204 0.09
205 0.08
206 0.07
207 0.08
208 0.06
209 0.06
210 0.06
211 0.06
212 0.06
213 0.06
214 0.07
215 0.07
216 0.07
217 0.06
218 0.07
219 0.09
220 0.1
221 0.16
222 0.2
223 0.21
224 0.22
225 0.23
226 0.24
227 0.24
228 0.26
229 0.22
230 0.18
231 0.17
232 0.17
233 0.15
234 0.13
235 0.12
236 0.09
237 0.07
238 0.09
239 0.08
240 0.08
241 0.11
242 0.14
243 0.14
244 0.15
245 0.22
246 0.22
247 0.31
248 0.33
249 0.32
250 0.34
251 0.35
252 0.34
253 0.31
254 0.33
255 0.3
256 0.31
257 0.32
258 0.29
259 0.29
260 0.3
261 0.26
262 0.23
263 0.17
264 0.14
265 0.14
266 0.15
267 0.16
268 0.15
269 0.17
270 0.18
271 0.18
272 0.21
273 0.23
274 0.28
275 0.29
276 0.29
277 0.29
278 0.28
279 0.27
280 0.27
281 0.21
282 0.13
283 0.12
284 0.12
285 0.11
286 0.13
287 0.13
288 0.12
289 0.15
290 0.16
291 0.18
292 0.18
293 0.18
294 0.19
295 0.19
296 0.19
297 0.17
298 0.17
299 0.14
300 0.14
301 0.12
302 0.14
303 0.2
304 0.22
305 0.25
306 0.24
307 0.27
308 0.27
309 0.29
310 0.29
311 0.26
312 0.28
313 0.25
314 0.26
315 0.23
316 0.21
317 0.19
318 0.15
319 0.11
320 0.06
321 0.08
322 0.09
323 0.1
324 0.15
325 0.15
326 0.17
327 0.17
328 0.19
329 0.25
330 0.31
331 0.36
332 0.38
333 0.46
334 0.46
335 0.47
336 0.46
337 0.42
338 0.4
339 0.36
340 0.33
341 0.32
342 0.4
343 0.47
344 0.51
345 0.55
346 0.54
347 0.59
348 0.65
349 0.68
350 0.69
351 0.69
352 0.74
353 0.75
354 0.75
355 0.72
356 0.65
357 0.6
358 0.53
359 0.52
360 0.47
361 0.4
362 0.37
363 0.43
364 0.43
365 0.45
366 0.47
367 0.4
368 0.43
369 0.44
370 0.51
371 0.52
372 0.56
373 0.57
374 0.58
375 0.58
376 0.57
377 0.56