Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9DSI0

Protein Details
Accession E9DSI0   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
27-55RMVKPLSFKGDKKPKKRKRTADADRDDGEBasic
NLS Segment(s)
PositionSequence
28-45MVKPLSFKGDKKPKKRKR
235-251FKPKLKASKEEKALSKI
Subcellular Location(s) nucl 19, cyto_nucl 12.5, mito 4, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008999  Actin-crosslinking  
IPR010414  FRG1  
Gene Ontology GO:0005730  C:nucleolus  
KEGG maw:MAC_00578  -  
Pfam View protein in Pfam  
PF06229  FRG1  
Amino Acid Sequences MELAASRSHAHRSPTPTAPSQTAPSRRMVKPLSFKGDKKPKKRKRTADADRDDGEAGPSRVQKVNDDDAAADDDSWVSADAATDVVGPVMIVLPTEKPSALACDPNGKVFAMPIENIVDGNPTSAEPHDVRMVWVANKVSGTDNFRFKGHHGRYLACDKIGFLSATSEAISPLECFNVIATADTPSTFQLQTLRETFVTVKPNTSSKSTSPAEVRGDEDKITFNTTMRIRMQARFKPKLKASKEEKALSKISRRELEEAVGRRLDENEVKVLKRARREGDYHERLLDLKVKNRHDKFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.55
3 0.55
4 0.55
5 0.53
6 0.5
7 0.48
8 0.5
9 0.51
10 0.47
11 0.49
12 0.53
13 0.51
14 0.55
15 0.55
16 0.54
17 0.57
18 0.63
19 0.64
20 0.63
21 0.65
22 0.67
23 0.73
24 0.74
25 0.76
26 0.79
27 0.8
28 0.85
29 0.92
30 0.92
31 0.91
32 0.93
33 0.93
34 0.93
35 0.89
36 0.84
37 0.75
38 0.66
39 0.56
40 0.44
41 0.35
42 0.28
43 0.22
44 0.19
45 0.19
46 0.21
47 0.24
48 0.25
49 0.27
50 0.29
51 0.33
52 0.31
53 0.3
54 0.27
55 0.24
56 0.26
57 0.22
58 0.15
59 0.1
60 0.09
61 0.08
62 0.08
63 0.07
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.04
72 0.04
73 0.04
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.04
80 0.05
81 0.07
82 0.08
83 0.08
84 0.08
85 0.09
86 0.13
87 0.14
88 0.16
89 0.15
90 0.21
91 0.22
92 0.22
93 0.23
94 0.18
95 0.17
96 0.14
97 0.15
98 0.09
99 0.09
100 0.09
101 0.09
102 0.09
103 0.09
104 0.09
105 0.08
106 0.07
107 0.07
108 0.06
109 0.05
110 0.06
111 0.06
112 0.09
113 0.09
114 0.11
115 0.12
116 0.12
117 0.12
118 0.13
119 0.14
120 0.11
121 0.13
122 0.12
123 0.11
124 0.11
125 0.11
126 0.11
127 0.12
128 0.17
129 0.17
130 0.21
131 0.21
132 0.21
133 0.21
134 0.21
135 0.3
136 0.27
137 0.3
138 0.28
139 0.28
140 0.32
141 0.36
142 0.35
143 0.25
144 0.23
145 0.17
146 0.16
147 0.16
148 0.12
149 0.07
150 0.07
151 0.07
152 0.08
153 0.08
154 0.07
155 0.06
156 0.06
157 0.06
158 0.06
159 0.06
160 0.06
161 0.05
162 0.05
163 0.05
164 0.06
165 0.06
166 0.05
167 0.06
168 0.07
169 0.07
170 0.07
171 0.08
172 0.08
173 0.1
174 0.09
175 0.09
176 0.12
177 0.14
178 0.17
179 0.18
180 0.19
181 0.17
182 0.19
183 0.2
184 0.2
185 0.25
186 0.22
187 0.23
188 0.23
189 0.26
190 0.27
191 0.29
192 0.28
193 0.23
194 0.3
195 0.29
196 0.31
197 0.3
198 0.32
199 0.32
200 0.3
201 0.31
202 0.26
203 0.27
204 0.24
205 0.22
206 0.19
207 0.17
208 0.19
209 0.17
210 0.14
211 0.19
212 0.19
213 0.24
214 0.23
215 0.29
216 0.29
217 0.35
218 0.43
219 0.45
220 0.53
221 0.57
222 0.6
223 0.62
224 0.66
225 0.7
226 0.67
227 0.7
228 0.69
229 0.68
230 0.73
231 0.71
232 0.68
233 0.63
234 0.63
235 0.59
236 0.59
237 0.55
238 0.55
239 0.54
240 0.53
241 0.52
242 0.48
243 0.47
244 0.46
245 0.44
246 0.41
247 0.36
248 0.33
249 0.3
250 0.3
251 0.3
252 0.26
253 0.25
254 0.28
255 0.3
256 0.31
257 0.35
258 0.41
259 0.42
260 0.46
261 0.52
262 0.51
263 0.54
264 0.58
265 0.62
266 0.66
267 0.67
268 0.62
269 0.55
270 0.49
271 0.43
272 0.42
273 0.41
274 0.35
275 0.36
276 0.42
277 0.49
278 0.59