Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3NNY5

Protein Details
Accession A0A0C3NNY5   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
6-26QSYACSLKQRHARRRSCSYSTHydrophilic
48-78SHSRKVTSYIRSKPKRSRSRSRAPRRSRRARBasic
NLS Segment(s)
PositionSequence
50-78SRKVTSYIRSKPKRSRSRSRAPRRSRRAR
Subcellular Location(s) mito 13, nucl 12, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences DFIPVQSYACSLKQRHARRRSCSYSTSSSPPSSLSSSSSSRSRSRSHSHSRKVTSYIRSKPKRSRSRSRAPRRSRRAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.59
3 0.66
4 0.71
5 0.72
6 0.81
7 0.81
8 0.76
9 0.7
10 0.65
11 0.61
12 0.56
13 0.53
14 0.47
15 0.39
16 0.35
17 0.32
18 0.28
19 0.24
20 0.21
21 0.18
22 0.18
23 0.19
24 0.21
25 0.23
26 0.24
27 0.25
28 0.28
29 0.29
30 0.32
31 0.36
32 0.42
33 0.51
34 0.57
35 0.62
36 0.67
37 0.69
38 0.66
39 0.65
40 0.63
41 0.6
42 0.59
43 0.6
44 0.62
45 0.66
46 0.72
47 0.76
48 0.81
49 0.83
50 0.83
51 0.85
52 0.84
53 0.88
54 0.9
55 0.92
56 0.92
57 0.92
58 0.94