Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3P283

Protein Details
Accession A0A0C3P283   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
271-295GSSHFADKCPKKARKAKARAAATTEHydrophilic
NLS Segment(s)
PositionSequence
281-289KKARKAKAR
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032567  LDOC1-rel  
IPR005162  Retrotrans_gag_dom  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF03732  Retrotrans_gag  
Amino Acid Sequences SSSRTKLHEPDTCNGTDPKKLHTFFIQCKLNFQDCPWAFKTDRAKVIFAQSYLKGMALEWFEPDLLGLDNPNDQPLWMDSWREFTLELQTTFGPHDPVADAKSQLDHLHMKDSQCINKYINFNWLASQVQGYGDGVLHHHFYSGLPDQIKDEVCQVGKPWILHKLCHLAQEIDVHYWECREEIQQAGKHQSSSNSNNNKSSGSARNNQSKTSQDKAKTGNNNNPRSSPKLGNNNNSNLSKPEPSKLGKDGKLTTEEHKCHIDGNLCMFCGGSSHFADKCPKKARKAKARAAATTEAALALGSGSTPKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.41
3 0.42
4 0.38
5 0.38
6 0.42
7 0.42
8 0.43
9 0.47
10 0.52
11 0.52
12 0.61
13 0.61
14 0.52
15 0.57
16 0.6
17 0.56
18 0.49
19 0.43
20 0.44
21 0.37
22 0.44
23 0.41
24 0.4
25 0.36
26 0.42
27 0.5
28 0.47
29 0.54
30 0.5
31 0.5
32 0.46
33 0.53
34 0.49
35 0.4
36 0.37
37 0.3
38 0.29
39 0.27
40 0.25
41 0.17
42 0.14
43 0.16
44 0.14
45 0.14
46 0.13
47 0.13
48 0.12
49 0.12
50 0.12
51 0.09
52 0.07
53 0.07
54 0.07
55 0.07
56 0.1
57 0.1
58 0.11
59 0.1
60 0.09
61 0.1
62 0.11
63 0.15
64 0.13
65 0.15
66 0.15
67 0.2
68 0.21
69 0.2
70 0.19
71 0.15
72 0.21
73 0.22
74 0.22
75 0.18
76 0.18
77 0.18
78 0.19
79 0.19
80 0.13
81 0.1
82 0.11
83 0.1
84 0.11
85 0.12
86 0.12
87 0.12
88 0.11
89 0.12
90 0.12
91 0.12
92 0.14
93 0.16
94 0.15
95 0.19
96 0.21
97 0.21
98 0.26
99 0.29
100 0.3
101 0.29
102 0.31
103 0.27
104 0.3
105 0.33
106 0.27
107 0.3
108 0.27
109 0.25
110 0.24
111 0.24
112 0.19
113 0.16
114 0.16
115 0.09
116 0.08
117 0.08
118 0.07
119 0.06
120 0.06
121 0.05
122 0.06
123 0.06
124 0.07
125 0.07
126 0.07
127 0.07
128 0.06
129 0.1
130 0.11
131 0.13
132 0.12
133 0.13
134 0.13
135 0.15
136 0.16
137 0.12
138 0.12
139 0.11
140 0.11
141 0.11
142 0.11
143 0.12
144 0.13
145 0.13
146 0.13
147 0.19
148 0.2
149 0.2
150 0.21
151 0.25
152 0.25
153 0.27
154 0.27
155 0.2
156 0.2
157 0.22
158 0.21
159 0.15
160 0.15
161 0.12
162 0.11
163 0.1
164 0.1
165 0.07
166 0.06
167 0.07
168 0.08
169 0.11
170 0.16
171 0.18
172 0.21
173 0.26
174 0.26
175 0.25
176 0.25
177 0.26
178 0.27
179 0.31
180 0.38
181 0.41
182 0.43
183 0.45
184 0.45
185 0.42
186 0.37
187 0.36
188 0.35
189 0.32
190 0.37
191 0.4
192 0.49
193 0.5
194 0.5
195 0.48
196 0.46
197 0.46
198 0.45
199 0.46
200 0.4
201 0.44
202 0.48
203 0.52
204 0.56
205 0.57
206 0.6
207 0.62
208 0.66
209 0.63
210 0.62
211 0.58
212 0.55
213 0.54
214 0.51
215 0.49
216 0.52
217 0.58
218 0.62
219 0.64
220 0.63
221 0.64
222 0.58
223 0.52
224 0.44
225 0.4
226 0.38
227 0.34
228 0.32
229 0.32
230 0.33
231 0.37
232 0.41
233 0.46
234 0.44
235 0.48
236 0.47
237 0.45
238 0.46
239 0.44
240 0.43
241 0.44
242 0.42
243 0.4
244 0.39
245 0.36
246 0.33
247 0.35
248 0.33
249 0.26
250 0.31
251 0.3
252 0.27
253 0.26
254 0.25
255 0.2
256 0.17
257 0.16
258 0.13
259 0.14
260 0.17
261 0.18
262 0.22
263 0.32
264 0.36
265 0.44
266 0.5
267 0.56
268 0.63
269 0.71
270 0.79
271 0.8
272 0.86
273 0.86
274 0.86
275 0.86
276 0.8
277 0.77
278 0.7
279 0.61
280 0.51
281 0.41
282 0.31
283 0.23
284 0.18
285 0.11
286 0.07
287 0.05
288 0.04