Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3PIK0

Protein Details
Accession A0A0C3PIK0    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
47-72VCYGCAPRERKRQTWKPPRPVHTKTMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 3
Family & Domain DBs
Amino Acid Sequences MDPAQDCYSRWCIFSSEHPKSCSHCWITCKHSHGKTREIQGGSPSYVCYGCAPRERKRQTWKPPRPVHTKTMSSQVSSHSFLGVSKLVTALAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.43
4 0.47
5 0.48
6 0.49
7 0.51
8 0.52
9 0.5
10 0.45
11 0.4
12 0.4
13 0.44
14 0.48
15 0.49
16 0.5
17 0.5
18 0.52
19 0.55
20 0.55
21 0.56
22 0.55
23 0.54
24 0.56
25 0.49
26 0.42
27 0.37
28 0.35
29 0.29
30 0.24
31 0.18
32 0.13
33 0.12
34 0.11
35 0.09
36 0.1
37 0.12
38 0.19
39 0.25
40 0.31
41 0.42
42 0.47
43 0.54
44 0.63
45 0.7
46 0.74
47 0.8
48 0.83
49 0.83
50 0.87
51 0.87
52 0.86
53 0.81
54 0.77
55 0.74
56 0.68
57 0.59
58 0.6
59 0.53
60 0.45
61 0.41
62 0.39
63 0.35
64 0.33
65 0.31
66 0.22
67 0.21
68 0.19
69 0.21
70 0.18
71 0.14
72 0.12
73 0.12