Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3ISS9

Protein Details
Accession A0A0C3ISS9   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
66-86ISIRLLKKRHASRPSWNRCFGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto 6, plas 6, mito 3, cyto_pero 3
Family & Domain DBs
Amino Acid Sequences MPKLRRHEQEVRDESILFVIFLVEGQIKHAPVPVELNISSSGGSMSRSWPVILWSLSALLAKARCISIRLLKKRHASRPSWNRCFGPSRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.37
3 0.3
4 0.19
5 0.13
6 0.08
7 0.06
8 0.06
9 0.07
10 0.06
11 0.05
12 0.08
13 0.1
14 0.1
15 0.1
16 0.13
17 0.12
18 0.12
19 0.14
20 0.12
21 0.14
22 0.14
23 0.15
24 0.13
25 0.13
26 0.12
27 0.1
28 0.09
29 0.06
30 0.07
31 0.06
32 0.07
33 0.08
34 0.08
35 0.08
36 0.08
37 0.09
38 0.11
39 0.1
40 0.1
41 0.09
42 0.09
43 0.09
44 0.09
45 0.08
46 0.07
47 0.08
48 0.08
49 0.09
50 0.09
51 0.09
52 0.11
53 0.15
54 0.22
55 0.32
56 0.4
57 0.45
58 0.52
59 0.61
60 0.69
61 0.75
62 0.74
63 0.7
64 0.73
65 0.78
66 0.82
67 0.8
68 0.78
69 0.7
70 0.67