Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9DY82

Protein Details
Accession E9DY82    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-35PRWWNSFVRRRVWIRKRARRRPADVDSSGHydrophilic
NLS Segment(s)
PositionSequence
16-27RRVWIRKRARRR
Subcellular Location(s) nucl 14.5, mito 10, cyto_nucl 9
Family & Domain DBs
KEGG maw:MAC_02580  -  
Amino Acid Sequences MFSWHEPRWWNSFVRRRVWIRKRARRRPADVDSSGHLLNSDYFTIRPASSRSSNRRSVASVASSRLPSKSSIARTSIKEMEEAQEIENIETLLSVLRSSRIDREKREAVENYLDHAMDLSQLQDEMHEIMSIFVFQASRRQLLTHLMRKYDDTARKLEDNDNKDDKNLLERKKALEAAVKHAEEEVSKLAYWSDVKKMAERGELRLSLDEDQGWYESHPGLDRSGPNAPNMGELP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.64
3 0.66
4 0.74
5 0.78
6 0.78
7 0.8
8 0.84
9 0.88
10 0.91
11 0.92
12 0.91
13 0.9
14 0.89
15 0.87
16 0.84
17 0.76
18 0.69
19 0.61
20 0.54
21 0.46
22 0.36
23 0.27
24 0.19
25 0.17
26 0.15
27 0.13
28 0.11
29 0.11
30 0.12
31 0.14
32 0.14
33 0.15
34 0.15
35 0.2
36 0.27
37 0.36
38 0.44
39 0.48
40 0.55
41 0.56
42 0.56
43 0.52
44 0.48
45 0.42
46 0.39
47 0.34
48 0.29
49 0.3
50 0.29
51 0.27
52 0.25
53 0.22
54 0.18
55 0.19
56 0.23
57 0.26
58 0.28
59 0.31
60 0.35
61 0.36
62 0.4
63 0.4
64 0.34
65 0.3
66 0.27
67 0.25
68 0.22
69 0.21
70 0.16
71 0.14
72 0.14
73 0.13
74 0.13
75 0.1
76 0.08
77 0.07
78 0.06
79 0.04
80 0.04
81 0.04
82 0.04
83 0.06
84 0.07
85 0.08
86 0.15
87 0.23
88 0.27
89 0.31
90 0.38
91 0.41
92 0.41
93 0.45
94 0.4
95 0.34
96 0.35
97 0.31
98 0.27
99 0.23
100 0.2
101 0.15
102 0.14
103 0.11
104 0.06
105 0.06
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.05
113 0.05
114 0.04
115 0.04
116 0.05
117 0.05
118 0.05
119 0.04
120 0.04
121 0.04
122 0.04
123 0.1
124 0.11
125 0.12
126 0.13
127 0.13
128 0.14
129 0.21
130 0.29
131 0.31
132 0.32
133 0.33
134 0.33
135 0.34
136 0.37
137 0.37
138 0.36
139 0.31
140 0.32
141 0.34
142 0.35
143 0.36
144 0.4
145 0.39
146 0.37
147 0.41
148 0.43
149 0.4
150 0.39
151 0.38
152 0.31
153 0.33
154 0.36
155 0.33
156 0.35
157 0.38
158 0.4
159 0.43
160 0.44
161 0.36
162 0.36
163 0.33
164 0.34
165 0.39
166 0.36
167 0.32
168 0.3
169 0.29
170 0.22
171 0.22
172 0.17
173 0.11
174 0.11
175 0.11
176 0.1
177 0.12
178 0.15
179 0.15
180 0.18
181 0.22
182 0.24
183 0.27
184 0.32
185 0.32
186 0.38
187 0.38
188 0.38
189 0.39
190 0.39
191 0.37
192 0.35
193 0.34
194 0.28
195 0.27
196 0.23
197 0.17
198 0.17
199 0.16
200 0.14
201 0.12
202 0.13
203 0.12
204 0.13
205 0.15
206 0.15
207 0.16
208 0.21
209 0.22
210 0.25
211 0.31
212 0.31
213 0.3
214 0.32
215 0.3