Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3PG84

Protein Details
Accession A0A0C3PG84   
Localization Confidence Low
Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
48-67NQLRRRHKTGKSLEKYHRKQBasic
NLS Segment(s)
Subcellular Location(s) cysk 21, cyto 3, nucl 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002524  Cation_efflux  
IPR027469  Cation_efflux_TMD_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0008324  F:monoatomic cation transmembrane transporter activity  
GO:0098771  P:inorganic ion homeostasis  
GO:0030003  P:intracellular monoatomic cation homeostasis  
Pfam View protein in Pfam  
PF01545  Cation_efflux  
Amino Acid Sequences MSPRLVNPSIASGVNMGGDIEVMPQIKDEHRPDPYRFRLGIMPDDELNQLRRRHKTGKSLEKYHRKQNELIASLLKSMDEHTEEARIDEEASRFAIRIAVWASLIANFSLCALQLYAAISSGSLSLIATGIDAVFDFGSNLFLYFMHKQAMKMDVNKWPVGGARLETIGNIIYGGVVPSC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.09
4 0.06
5 0.06
6 0.05
7 0.05
8 0.07
9 0.07
10 0.07
11 0.08
12 0.1
13 0.12
14 0.2
15 0.23
16 0.28
17 0.35
18 0.4
19 0.45
20 0.52
21 0.56
22 0.56
23 0.52
24 0.48
25 0.45
26 0.43
27 0.44
28 0.36
29 0.32
30 0.25
31 0.26
32 0.25
33 0.23
34 0.23
35 0.23
36 0.26
37 0.31
38 0.36
39 0.41
40 0.47
41 0.52
42 0.59
43 0.64
44 0.69
45 0.7
46 0.74
47 0.78
48 0.81
49 0.79
50 0.79
51 0.76
52 0.68
53 0.62
54 0.61
55 0.59
56 0.49
57 0.46
58 0.38
59 0.3
60 0.27
61 0.25
62 0.17
63 0.09
64 0.08
65 0.08
66 0.08
67 0.09
68 0.09
69 0.11
70 0.11
71 0.11
72 0.1
73 0.09
74 0.08
75 0.09
76 0.08
77 0.07
78 0.08
79 0.08
80 0.07
81 0.07
82 0.08
83 0.07
84 0.08
85 0.08
86 0.08
87 0.08
88 0.08
89 0.08
90 0.07
91 0.08
92 0.06
93 0.05
94 0.04
95 0.05
96 0.05
97 0.05
98 0.04
99 0.04
100 0.04
101 0.05
102 0.06
103 0.05
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.04
110 0.04
111 0.04
112 0.03
113 0.04
114 0.04
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.06
126 0.06
127 0.06
128 0.06
129 0.06
130 0.11
131 0.12
132 0.13
133 0.16
134 0.17
135 0.17
136 0.2
137 0.26
138 0.26
139 0.28
140 0.31
141 0.35
142 0.38
143 0.38
144 0.35
145 0.3
146 0.28
147 0.26
148 0.24
149 0.18
150 0.16
151 0.17
152 0.17
153 0.16
154 0.15
155 0.13
156 0.11
157 0.09
158 0.07
159 0.06
160 0.06