Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3PHN9

Protein Details
Accession A0A0C3PHN9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGPQFSRHVRRPVRWQRRCSRFANHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
Amino Acid Sequences MGPQFSRHVRRPVRWQRRCSRFANTLSLPLEAAPQVKRPPLRPGPIPVVADVEDSEGNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.83
3 0.84
4 0.85
5 0.84
6 0.77
7 0.73
8 0.69
9 0.63
10 0.61
11 0.51
12 0.46
13 0.41
14 0.37
15 0.29
16 0.22
17 0.19
18 0.12
19 0.13
20 0.09
21 0.11
22 0.13
23 0.17
24 0.2
25 0.22
26 0.31
27 0.37
28 0.42
29 0.42
30 0.47
31 0.49
32 0.52
33 0.5
34 0.41
35 0.37
36 0.32
37 0.29
38 0.23
39 0.19