Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3IQD0

Protein Details
Accession A0A0C3IQD0   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
94-120TPPSYDHRSRRTRFPWRPTKQIYCDRYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
Amino Acid Sequences MHYYSSETLRAEFDGDNPRSTTRSRLVGIITRHSVPLIKTAESEKRLRKQLKIGIFLIRSQIRPPSTKPVIEREVLHRKRTAEMNIPYLPRAPTPPSYDHRSRRTRFPWRPTKQIYCDRYELRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.28
4 0.28
5 0.29
6 0.29
7 0.3
8 0.31
9 0.26
10 0.3
11 0.29
12 0.29
13 0.31
14 0.34
15 0.36
16 0.35
17 0.33
18 0.29
19 0.28
20 0.26
21 0.25
22 0.19
23 0.23
24 0.2
25 0.17
26 0.18
27 0.22
28 0.28
29 0.3
30 0.35
31 0.36
32 0.4
33 0.48
34 0.51
35 0.5
36 0.52
37 0.55
38 0.55
39 0.52
40 0.47
41 0.43
42 0.4
43 0.37
44 0.34
45 0.29
46 0.23
47 0.19
48 0.22
49 0.19
50 0.2
51 0.23
52 0.27
53 0.28
54 0.3
55 0.31
56 0.34
57 0.34
58 0.34
59 0.33
60 0.33
61 0.41
62 0.42
63 0.42
64 0.39
65 0.37
66 0.38
67 0.41
68 0.37
69 0.35
70 0.35
71 0.38
72 0.39
73 0.38
74 0.36
75 0.33
76 0.3
77 0.22
78 0.23
79 0.21
80 0.22
81 0.26
82 0.32
83 0.35
84 0.42
85 0.5
86 0.55
87 0.61
88 0.67
89 0.66
90 0.7
91 0.74
92 0.78
93 0.78
94 0.81
95 0.82
96 0.8
97 0.86
98 0.85
99 0.85
100 0.83
101 0.83
102 0.78
103 0.73
104 0.73