Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3P9B9

Protein Details
Accession A0A0C3P9B9   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
13-40SRGTEYQPSQRRRKRKHGFLARKKTANGHydrophilic
NLS Segment(s)
PositionSequence
23-53RRRKRKHGFLARKKTANGRKILRRRLAKGRL
Subcellular Location(s) nucl 13.5, cyto_nucl 10, mito 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences PSLFPAYQQRFASRGTEYQPSQRRRKRKHGFLARKKTANGRKILRRRLAKGRLALSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.25
3 0.3
4 0.28
5 0.36
6 0.43
7 0.48
8 0.56
9 0.6
10 0.67
11 0.7
12 0.79
13 0.8
14 0.82
15 0.85
16 0.86
17 0.89
18 0.89
19 0.92
20 0.87
21 0.81
22 0.72
23 0.71
24 0.69
25 0.64
26 0.61
27 0.59
28 0.63
29 0.69
30 0.77
31 0.76
32 0.76
33 0.76
34 0.79
35 0.8
36 0.76
37 0.74