Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3PS16

Protein Details
Accession A0A0C3PS16    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
29-56IYIICGCQKKRPDQRRRQSPHTPKLDEVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSRAKSAQLERKSPYTHGYGTDPALNRGIYIICGCQKKRPDQRRRQSPHTPKLDEVIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.41
3 0.35
4 0.32
5 0.31
6 0.27
7 0.25
8 0.28
9 0.25
10 0.21
11 0.22
12 0.19
13 0.15
14 0.13
15 0.12
16 0.08
17 0.08
18 0.08
19 0.11
20 0.16
21 0.17
22 0.22
23 0.28
24 0.37
25 0.48
26 0.57
27 0.64
28 0.71
29 0.82
30 0.87
31 0.9
32 0.89
33 0.9
34 0.9
35 0.88
36 0.87
37 0.81
38 0.71