Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3JFQ6

Protein Details
Accession A0A0C3JFQ6   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
29-59RGQRGRELRLRRQHGRLRRRVCKEEERWEAKBasic
NLS Segment(s)
PositionSequence
32-51RGRELRLRRQHGRLRRRVCK
Subcellular Location(s) cyto 13, cyto_nucl 12.333, nucl 9.5, mito_nucl 6.166
Family & Domain DBs
Amino Acid Sequences MSDSRPTTAADNNNEGQVIVDWAQVPNVRGQRGRELRLRRQHGRLRRRVCKEEERWEAKHKCKAEARKGSEAVASGSEASKVKKVVMDPGCTHCSQANVVCKFLIDSNKKQVACIWCNLLKGKCWWPGDGKDAEGKVDKGKNQKVNDEGIEAGPSKQKQAKTSVRPVEVLDLDEPEPGGSRSQETDAEHYSGLEEKLEYLIDAVGLIANNLASLFKLHKTAVENSGCIADMLKSLLDESYGFRMAVPPSDLGLSELDSDELHEEADWLKAHGKDEEEESGGEDETMAEAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.33
3 0.27
4 0.2
5 0.18
6 0.12
7 0.13
8 0.12
9 0.12
10 0.15
11 0.16
12 0.17
13 0.21
14 0.24
15 0.27
16 0.3
17 0.33
18 0.41
19 0.47
20 0.52
21 0.53
22 0.58
23 0.64
24 0.71
25 0.76
26 0.73
27 0.75
28 0.79
29 0.81
30 0.83
31 0.83
32 0.83
33 0.84
34 0.86
35 0.84
36 0.83
37 0.83
38 0.81
39 0.8
40 0.8
41 0.77
42 0.72
43 0.74
44 0.74
45 0.7
46 0.69
47 0.62
48 0.6
49 0.61
50 0.67
51 0.68
52 0.7
53 0.7
54 0.7
55 0.69
56 0.62
57 0.54
58 0.45
59 0.35
60 0.25
61 0.19
62 0.12
63 0.11
64 0.12
65 0.11
66 0.12
67 0.13
68 0.13
69 0.14
70 0.16
71 0.16
72 0.24
73 0.27
74 0.31
75 0.31
76 0.36
77 0.38
78 0.36
79 0.36
80 0.28
81 0.24
82 0.21
83 0.23
84 0.27
85 0.24
86 0.25
87 0.24
88 0.23
89 0.22
90 0.23
91 0.27
92 0.24
93 0.27
94 0.35
95 0.41
96 0.41
97 0.4
98 0.42
99 0.4
100 0.37
101 0.35
102 0.31
103 0.27
104 0.29
105 0.32
106 0.28
107 0.23
108 0.24
109 0.28
110 0.3
111 0.29
112 0.3
113 0.3
114 0.32
115 0.35
116 0.32
117 0.28
118 0.24
119 0.23
120 0.22
121 0.19
122 0.17
123 0.16
124 0.18
125 0.2
126 0.25
127 0.31
128 0.37
129 0.37
130 0.4
131 0.38
132 0.38
133 0.35
134 0.28
135 0.23
136 0.16
137 0.15
138 0.12
139 0.11
140 0.11
141 0.11
142 0.13
143 0.16
144 0.18
145 0.2
146 0.28
147 0.36
148 0.4
149 0.5
150 0.53
151 0.5
152 0.49
153 0.47
154 0.41
155 0.33
156 0.27
157 0.18
158 0.14
159 0.13
160 0.12
161 0.11
162 0.08
163 0.08
164 0.07
165 0.08
166 0.06
167 0.07
168 0.09
169 0.1
170 0.13
171 0.14
172 0.17
173 0.18
174 0.19
175 0.18
176 0.16
177 0.15
178 0.14
179 0.13
180 0.1
181 0.08
182 0.07
183 0.07
184 0.07
185 0.07
186 0.05
187 0.05
188 0.05
189 0.04
190 0.04
191 0.04
192 0.04
193 0.04
194 0.04
195 0.03
196 0.03
197 0.04
198 0.04
199 0.03
200 0.05
201 0.07
202 0.08
203 0.11
204 0.11
205 0.14
206 0.19
207 0.22
208 0.29
209 0.29
210 0.28
211 0.26
212 0.27
213 0.24
214 0.2
215 0.16
216 0.09
217 0.07
218 0.08
219 0.08
220 0.07
221 0.07
222 0.07
223 0.07
224 0.07
225 0.09
226 0.12
227 0.13
228 0.13
229 0.13
230 0.16
231 0.16
232 0.18
233 0.18
234 0.15
235 0.15
236 0.15
237 0.15
238 0.14
239 0.13
240 0.12
241 0.11
242 0.1
243 0.1
244 0.09
245 0.1
246 0.1
247 0.09
248 0.08
249 0.07
250 0.08
251 0.08
252 0.11
253 0.11
254 0.11
255 0.15
256 0.17
257 0.19
258 0.22
259 0.24
260 0.23
261 0.26
262 0.28
263 0.25
264 0.23
265 0.24
266 0.22
267 0.19
268 0.17
269 0.13
270 0.1