Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3PCC5

Protein Details
Accession A0A0C3PCC5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
428-451IRFGVPSARRYLRKHNRKRKAKSABasic
NLS Segment(s)
PositionSequence
436-451RRYLRKHNRKRKAKSA
Subcellular Location(s) plas 24, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004277  PSS  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0106245  F:L-serine-phosphatidylethanolamine phosphatidyltransferase activity  
GO:0006659  P:phosphatidylserine biosynthetic process  
Pfam View protein in Pfam  
PF03034  PSS  
Amino Acid Sequences MLSETTDSPASPLQDDDDVIVSPPEAEPQPGINGNTVRWYDADRTEPYTRIAPFQERHDTSVEFFYKPITLTALTIGLAALAYIAMTQDLLEEGRDKRRIGAYAALVSFLMFSMIQFRDGPFVRPHPAFWRVVLGVNLLYELALVFLLFQDLDSARSMMTLLDPSLGVPLPEKSYAENCAVTVDNIWDAIDIFCLAHALGWFGKAMILRDYWFCWILSIAFELAEYSLQHQLPNFAECWWDHWVLDVLVCNWLGTYLGMKTCQYLEVKPYEWRGLRQTRGLRSKARRVLSQFSPHDWTAFKWEGTASFYHYTTVVLLLAVFLAAELNPFYLKSLLWLEPDHPFVILRLAGVFLCALPAVRELYQYVNDPNSRKAKRMGQHCWLLLATILTELLVITKWSRGLFEEPLPRYVRWAWTIGGVLLLLYPAIRFGVPSARRYLRKHNRKRKAKSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.18
4 0.16
5 0.15
6 0.14
7 0.13
8 0.11
9 0.1
10 0.1
11 0.12
12 0.11
13 0.12
14 0.13
15 0.15
16 0.19
17 0.22
18 0.23
19 0.24
20 0.25
21 0.25
22 0.3
23 0.28
24 0.25
25 0.22
26 0.25
27 0.25
28 0.27
29 0.32
30 0.29
31 0.35
32 0.37
33 0.37
34 0.36
35 0.37
36 0.34
37 0.33
38 0.35
39 0.36
40 0.36
41 0.42
42 0.49
43 0.46
44 0.47
45 0.46
46 0.43
47 0.37
48 0.42
49 0.38
50 0.28
51 0.26
52 0.25
53 0.23
54 0.22
55 0.2
56 0.15
57 0.13
58 0.13
59 0.14
60 0.13
61 0.12
62 0.11
63 0.1
64 0.07
65 0.06
66 0.05
67 0.04
68 0.03
69 0.03
70 0.02
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.04
77 0.04
78 0.05
79 0.09
80 0.12
81 0.19
82 0.23
83 0.23
84 0.26
85 0.3
86 0.32
87 0.31
88 0.34
89 0.29
90 0.31
91 0.3
92 0.27
93 0.23
94 0.2
95 0.18
96 0.12
97 0.1
98 0.05
99 0.04
100 0.1
101 0.1
102 0.12
103 0.12
104 0.13
105 0.18
106 0.19
107 0.22
108 0.21
109 0.24
110 0.28
111 0.28
112 0.3
113 0.3
114 0.34
115 0.32
116 0.29
117 0.3
118 0.25
119 0.26
120 0.25
121 0.2
122 0.15
123 0.14
124 0.13
125 0.08
126 0.07
127 0.05
128 0.04
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.05
138 0.05
139 0.06
140 0.07
141 0.08
142 0.07
143 0.07
144 0.08
145 0.06
146 0.07
147 0.06
148 0.06
149 0.06
150 0.06
151 0.06
152 0.07
153 0.07
154 0.06
155 0.06
156 0.07
157 0.09
158 0.1
159 0.1
160 0.1
161 0.12
162 0.15
163 0.16
164 0.15
165 0.13
166 0.14
167 0.14
168 0.12
169 0.11
170 0.09
171 0.07
172 0.07
173 0.07
174 0.05
175 0.05
176 0.05
177 0.05
178 0.04
179 0.04
180 0.04
181 0.04
182 0.04
183 0.04
184 0.04
185 0.05
186 0.05
187 0.05
188 0.05
189 0.05
190 0.06
191 0.07
192 0.07
193 0.08
194 0.08
195 0.09
196 0.1
197 0.1
198 0.11
199 0.11
200 0.1
201 0.09
202 0.09
203 0.08
204 0.08
205 0.07
206 0.06
207 0.05
208 0.05
209 0.05
210 0.04
211 0.05
212 0.04
213 0.05
214 0.09
215 0.09
216 0.1
217 0.1
218 0.12
219 0.12
220 0.14
221 0.12
222 0.09
223 0.1
224 0.1
225 0.13
226 0.14
227 0.14
228 0.13
229 0.13
230 0.14
231 0.13
232 0.13
233 0.1
234 0.07
235 0.08
236 0.08
237 0.07
238 0.06
239 0.06
240 0.05
241 0.05
242 0.05
243 0.05
244 0.06
245 0.07
246 0.07
247 0.08
248 0.08
249 0.11
250 0.12
251 0.12
252 0.14
253 0.16
254 0.18
255 0.2
256 0.22
257 0.25
258 0.25
259 0.26
260 0.31
261 0.35
262 0.35
263 0.4
264 0.44
265 0.47
266 0.54
267 0.56
268 0.57
269 0.57
270 0.64
271 0.65
272 0.62
273 0.58
274 0.56
275 0.58
276 0.55
277 0.57
278 0.49
279 0.45
280 0.47
281 0.42
282 0.38
283 0.33
284 0.27
285 0.25
286 0.25
287 0.21
288 0.17
289 0.17
290 0.17
291 0.19
292 0.18
293 0.15
294 0.16
295 0.16
296 0.16
297 0.16
298 0.15
299 0.13
300 0.13
301 0.08
302 0.06
303 0.06
304 0.05
305 0.05
306 0.04
307 0.03
308 0.03
309 0.03
310 0.02
311 0.03
312 0.03
313 0.04
314 0.04
315 0.05
316 0.06
317 0.06
318 0.06
319 0.09
320 0.13
321 0.14
322 0.16
323 0.16
324 0.18
325 0.2
326 0.22
327 0.2
328 0.16
329 0.14
330 0.13
331 0.14
332 0.12
333 0.1
334 0.08
335 0.08
336 0.08
337 0.08
338 0.08
339 0.05
340 0.05
341 0.05
342 0.05
343 0.05
344 0.07
345 0.09
346 0.09
347 0.1
348 0.11
349 0.14
350 0.16
351 0.17
352 0.19
353 0.22
354 0.26
355 0.28
356 0.34
357 0.41
358 0.41
359 0.43
360 0.47
361 0.5
362 0.54
363 0.62
364 0.63
365 0.61
366 0.66
367 0.63
368 0.58
369 0.49
370 0.42
371 0.33
372 0.25
373 0.16
374 0.09
375 0.09
376 0.06
377 0.06
378 0.05
379 0.05
380 0.05
381 0.06
382 0.06
383 0.08
384 0.11
385 0.11
386 0.13
387 0.15
388 0.19
389 0.23
390 0.29
391 0.37
392 0.37
393 0.42
394 0.45
395 0.41
396 0.42
397 0.41
398 0.4
399 0.34
400 0.34
401 0.29
402 0.28
403 0.3
404 0.25
405 0.22
406 0.16
407 0.12
408 0.1
409 0.09
410 0.06
411 0.05
412 0.04
413 0.04
414 0.05
415 0.05
416 0.06
417 0.08
418 0.18
419 0.22
420 0.26
421 0.34
422 0.41
423 0.48
424 0.54
425 0.63
426 0.65
427 0.72
428 0.81
429 0.83
430 0.87
431 0.9