Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3PV75

Protein Details
Accession A0A0C3PV75    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
82-107LELLRNSKDKKARKLTKKRLGTMLRSHydrophilic
NLS Segment(s)
PositionSequence
88-110SKDKKARKLTKKRLGTMLRSKRK
Subcellular Location(s) mito 20, nucl 6, cyto_nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MITVVSAQRDVTRSSNVNPRRTVKIMARTNLRYGLNKGYPTTPLPKASRPSQRKGIQSTKNKFVHSIIREVAGFSPYERRVLELLRNSKDKKARKLTKKRLGTMLRSKRKLEELGTVIQESRRAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.39
3 0.44
4 0.49
5 0.52
6 0.53
7 0.54
8 0.55
9 0.56
10 0.54
11 0.56
12 0.57
13 0.56
14 0.59
15 0.55
16 0.55
17 0.54
18 0.49
19 0.41
20 0.37
21 0.39
22 0.35
23 0.34
24 0.33
25 0.29
26 0.29
27 0.29
28 0.31
29 0.26
30 0.29
31 0.3
32 0.34
33 0.37
34 0.42
35 0.5
36 0.51
37 0.53
38 0.57
39 0.59
40 0.6
41 0.62
42 0.64
43 0.63
44 0.67
45 0.66
46 0.66
47 0.63
48 0.59
49 0.52
50 0.45
51 0.44
52 0.35
53 0.34
54 0.25
55 0.22
56 0.22
57 0.21
58 0.2
59 0.12
60 0.11
61 0.08
62 0.13
63 0.13
64 0.15
65 0.14
66 0.16
67 0.16
68 0.18
69 0.24
70 0.26
71 0.32
72 0.34
73 0.41
74 0.41
75 0.46
76 0.53
77 0.55
78 0.57
79 0.62
80 0.68
81 0.73
82 0.82
83 0.87
84 0.89
85 0.9
86 0.85
87 0.84
88 0.8
89 0.79
90 0.78
91 0.78
92 0.78
93 0.74
94 0.72
95 0.66
96 0.65
97 0.61
98 0.53
99 0.5
100 0.44
101 0.44
102 0.44
103 0.4
104 0.35
105 0.32