Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3J559

Protein Details
Accession A0A0C3J559    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
56-78LANKVAKKRIHHHLKGRRRVDNWBasic
NLS Segment(s)
PositionSequence
61-74AKKRIHHHLKGRRR
Subcellular Location(s) cyto 16.5, cyto_nucl 11, nucl 4.5, mito 4
Family & Domain DBs
Amino Acid Sequences MVSVKNWWWRRVVGSGTWENDRGEEGQCGIWGASVAKIEEVRDGKHAVHIDDNYPLANKVAKKRIHHHLKGRRRVDNW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.39
4 0.39
5 0.36
6 0.31
7 0.28
8 0.25
9 0.19
10 0.16
11 0.13
12 0.12
13 0.11
14 0.1
15 0.1
16 0.09
17 0.07
18 0.06
19 0.06
20 0.06
21 0.06
22 0.06
23 0.06
24 0.07
25 0.07
26 0.1
27 0.11
28 0.11
29 0.12
30 0.13
31 0.13
32 0.16
33 0.17
34 0.15
35 0.17
36 0.17
37 0.16
38 0.17
39 0.17
40 0.14
41 0.13
42 0.13
43 0.1
44 0.13
45 0.17
46 0.23
47 0.31
48 0.37
49 0.42
50 0.49
51 0.59
52 0.67
53 0.71
54 0.74
55 0.77
56 0.82
57 0.86
58 0.87