Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3NP99

Protein Details
Accession A0A0C3NP99    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
77-103QDTVKAKPVKPKPKPKGRQGRPTNISDHydrophilic
NLS Segment(s)
PositionSequence
81-97KAKPVKPKPKPKGRQGR
Subcellular Location(s) nucl 19.5, cyto_nucl 12.833, mito_nucl 12.166, cyto 4
Family & Domain DBs
Amino Acid Sequences MSADDSSRSHCPQREKANLHPGQIVLDAQVKRRTSSQKKADDSRAKDLSDACTAVVQQGCTRILEMEATMEVEQATQDTVKAKPVKPKPKPKGRQGRPTNISDLPRGEVANIEVEAHHVTADNFLGSSNKPPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.65
3 0.7
4 0.74
5 0.72
6 0.66
7 0.59
8 0.49
9 0.4
10 0.35
11 0.26
12 0.17
13 0.2
14 0.19
15 0.21
16 0.27
17 0.26
18 0.26
19 0.32
20 0.41
21 0.43
22 0.53
23 0.58
24 0.61
25 0.67
26 0.72
27 0.76
28 0.75
29 0.71
30 0.69
31 0.63
32 0.54
33 0.49
34 0.44
35 0.36
36 0.29
37 0.24
38 0.16
39 0.13
40 0.13
41 0.13
42 0.13
43 0.1
44 0.08
45 0.11
46 0.11
47 0.1
48 0.11
49 0.09
50 0.08
51 0.08
52 0.07
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.04
60 0.04
61 0.04
62 0.04
63 0.03
64 0.04
65 0.06
66 0.06
67 0.13
68 0.18
69 0.2
70 0.29
71 0.39
72 0.5
73 0.58
74 0.69
75 0.73
76 0.8
77 0.86
78 0.87
79 0.89
80 0.88
81 0.89
82 0.87
83 0.87
84 0.81
85 0.76
86 0.71
87 0.64
88 0.57
89 0.49
90 0.42
91 0.33
92 0.29
93 0.26
94 0.2
95 0.17
96 0.15
97 0.15
98 0.13
99 0.11
100 0.1
101 0.11
102 0.12
103 0.11
104 0.1
105 0.08
106 0.08
107 0.1
108 0.11
109 0.09
110 0.08
111 0.08
112 0.11
113 0.11