Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9D3U6

Protein Details
Accession E9D3U6    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-32AAKPPIKVPSSRKKPMRPRDAPTGRLHydrophilic
NLS Segment(s)
PositionSequence
9-28KPPIKVPSSRKKPMRPRDAP
122-130GYDKRRLKK
Subcellular Location(s) mito 17, cyto 6, nucl 4
Family & Domain DBs
Amino Acid Sequences MTARDHAAKPPIKVPSSRKKPMRPRDAPTGRLPRHGENACWLRAPSVVGAGSTIIRILCYEIPPPQEEGSGTNPGYIGISNVIFGLVACQPSRVPNTYSDLKLFREYAKREKVENRQGAVKGYDKRRLKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.56
3 0.62
4 0.69
5 0.72
6 0.75
7 0.83
8 0.86
9 0.89
10 0.85
11 0.82
12 0.83
13 0.81
14 0.76
15 0.74
16 0.74
17 0.65
18 0.64
19 0.61
20 0.54
21 0.55
22 0.52
23 0.43
24 0.41
25 0.43
26 0.36
27 0.34
28 0.3
29 0.22
30 0.21
31 0.21
32 0.13
33 0.11
34 0.1
35 0.08
36 0.09
37 0.08
38 0.08
39 0.07
40 0.07
41 0.04
42 0.04
43 0.04
44 0.06
45 0.06
46 0.07
47 0.09
48 0.1
49 0.12
50 0.13
51 0.15
52 0.13
53 0.13
54 0.12
55 0.13
56 0.14
57 0.16
58 0.16
59 0.14
60 0.14
61 0.13
62 0.13
63 0.11
64 0.08
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.04
72 0.06
73 0.06
74 0.07
75 0.07
76 0.08
77 0.08
78 0.12
79 0.16
80 0.16
81 0.17
82 0.19
83 0.25
84 0.29
85 0.3
86 0.31
87 0.3
88 0.3
89 0.32
90 0.31
91 0.3
92 0.33
93 0.37
94 0.43
95 0.49
96 0.49
97 0.52
98 0.6
99 0.65
100 0.67
101 0.69
102 0.63
103 0.6
104 0.59
105 0.57
106 0.52
107 0.49
108 0.47
109 0.47
110 0.53