Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3P201

Protein Details
Accession A0A0C3P201   
Localization Confidence High
Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
95-118APAHKKAAPVNKRRKKPVEQEDIFHydrophilic
133-153MAHARNQPRVGRPPKKQKNGFHydrophilic
NLS Segment(s)
PositionSequence
98-110HKKAAPVNKRRKK
141-150RVGRPPKKQK
Subcellular Location(s) nucl 16.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MLTRVVYRSCVPASSSSRDSDISENTNDSIASVNRPVIHSNGQHQPERDVSPLTSDEDEDMGDEAPPPVRKTVPANKRCAASLLTNGNEDPEALAPAHKKAAPVNKRRKKPVEQEDIFTDAVDSPGTKTRNAMAHARNQPRVGRPPKKQKNGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.34
4 0.35
5 0.35
6 0.35
7 0.31
8 0.29
9 0.26
10 0.25
11 0.25
12 0.23
13 0.22
14 0.19
15 0.16
16 0.15
17 0.12
18 0.13
19 0.13
20 0.14
21 0.15
22 0.17
23 0.18
24 0.18
25 0.22
26 0.22
27 0.26
28 0.32
29 0.35
30 0.36
31 0.35
32 0.35
33 0.34
34 0.34
35 0.3
36 0.24
37 0.2
38 0.2
39 0.2
40 0.19
41 0.16
42 0.14
43 0.13
44 0.12
45 0.11
46 0.09
47 0.08
48 0.06
49 0.06
50 0.06
51 0.05
52 0.07
53 0.09
54 0.09
55 0.1
56 0.1
57 0.12
58 0.18
59 0.27
60 0.35
61 0.41
62 0.46
63 0.47
64 0.47
65 0.46
66 0.41
67 0.34
68 0.25
69 0.23
70 0.21
71 0.19
72 0.19
73 0.19
74 0.17
75 0.15
76 0.13
77 0.09
78 0.06
79 0.06
80 0.06
81 0.07
82 0.08
83 0.09
84 0.11
85 0.12
86 0.12
87 0.16
88 0.26
89 0.34
90 0.44
91 0.54
92 0.61
93 0.68
94 0.77
95 0.8
96 0.8
97 0.81
98 0.81
99 0.81
100 0.74
101 0.7
102 0.64
103 0.6
104 0.5
105 0.39
106 0.29
107 0.18
108 0.16
109 0.13
110 0.1
111 0.08
112 0.14
113 0.16
114 0.16
115 0.17
116 0.21
117 0.26
118 0.3
119 0.36
120 0.34
121 0.43
122 0.52
123 0.59
124 0.59
125 0.58
126 0.59
127 0.59
128 0.64
129 0.65
130 0.66
131 0.69
132 0.75
133 0.82