Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3NVV6

Protein Details
Accession A0A0C3NVV6    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-28EVEQKSGSKKSPKKNSKKHGHQDEVEDBasic
NLS Segment(s)
PositionSequence
9-19SKKSPKKNSKK
48-62PTRKHGPKASKGKGK
Subcellular Location(s) nucl 10.5, mito 10, cyto_nucl 9, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MEVEQKSGSKKSPKKNSKKHGHQDEVEDTAGTETGGVSEAVSPPKEIPTRKHGPKASKGKGKDGGISQEWEAPSVASGSNVPVEMAEKATVYQHKASVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.86
3 0.9
4 0.91
5 0.94
6 0.94
7 0.93
8 0.9
9 0.82
10 0.78
11 0.7
12 0.62
13 0.51
14 0.4
15 0.29
16 0.21
17 0.18
18 0.11
19 0.07
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.05
26 0.06
27 0.08
28 0.08
29 0.08
30 0.08
31 0.12
32 0.16
33 0.17
34 0.2
35 0.27
36 0.35
37 0.39
38 0.46
39 0.47
40 0.5
41 0.58
42 0.65
43 0.65
44 0.64
45 0.62
46 0.61
47 0.62
48 0.57
49 0.51
50 0.43
51 0.39
52 0.33
53 0.33
54 0.27
55 0.24
56 0.22
57 0.2
58 0.17
59 0.12
60 0.11
61 0.1
62 0.1
63 0.07
64 0.07
65 0.07
66 0.08
67 0.08
68 0.08
69 0.07
70 0.09
71 0.09
72 0.1
73 0.1
74 0.09
75 0.1
76 0.15
77 0.18
78 0.21
79 0.22