Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3NLZ4

Protein Details
Accession A0A0C3NLZ4    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MGRSAKVHKRVKQMKKPQLQPAPPPHydrophilic
NLS Segment(s)
PositionSequence
6-63KVHKRVKQMKKPQLQPAPPPEPKPKLKSSAPASTEIQSAKKRSDLRSKVKNKGKSIAK
Subcellular Location(s) nucl 15, mito 7, cyto 5
Family & Domain DBs
Amino Acid Sequences MGRSAKVHKRVKQMKKPQLQPAPPPEPKPKLKSSAPASTEIQSAKKRSDLRSKVKNKGKSIAKGADGGHVLAGADYVTLMMGGRRKAAEEALKLPPDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.89
4 0.88
5 0.88
6 0.82
7 0.8
8 0.78
9 0.77
10 0.71
11 0.69
12 0.67
13 0.64
14 0.66
15 0.63
16 0.59
17 0.56
18 0.55
19 0.58
20 0.56
21 0.56
22 0.51
23 0.49
24 0.45
25 0.4
26 0.39
27 0.31
28 0.29
29 0.24
30 0.24
31 0.21
32 0.25
33 0.28
34 0.31
35 0.4
36 0.44
37 0.49
38 0.58
39 0.65
40 0.69
41 0.73
42 0.76
43 0.69
44 0.69
45 0.67
46 0.62
47 0.61
48 0.55
49 0.48
50 0.43
51 0.4
52 0.35
53 0.28
54 0.23
55 0.16
56 0.12
57 0.11
58 0.07
59 0.07
60 0.04
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.05
68 0.08
69 0.09
70 0.12
71 0.12
72 0.14
73 0.16
74 0.22
75 0.26
76 0.27
77 0.31
78 0.36