Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3NRJ9

Protein Details
Accession A0A0C3NRJ9    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
22-41ATRIFLRKGEKQRRRSLPKTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 6.5, cyto_nucl 6.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013632  DNA_recomb/repair_Rad51_C  
Pfam View protein in Pfam  
PF08423  Rad51  
Amino Acid Sequences MTFVAGGALKPVGGHILSHASATRIFLRKGEKQRRRSLPKTLVVDFMNQFPMILPVYITN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.11
4 0.11
5 0.12
6 0.12
7 0.11
8 0.11
9 0.13
10 0.17
11 0.16
12 0.16
13 0.18
14 0.24
15 0.3
16 0.41
17 0.5
18 0.54
19 0.59
20 0.69
21 0.76
22 0.8
23 0.77
24 0.77
25 0.74
26 0.73
27 0.71
28 0.63
29 0.57
30 0.48
31 0.47
32 0.38
33 0.31
34 0.26
35 0.2
36 0.18
37 0.14
38 0.16
39 0.12
40 0.11