Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3PWC3

Protein Details
Accession A0A0C3PWC3    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
60-81HEGSAKHPPTPKRRARKQPKPQBasic
NLS Segment(s)
PositionSequence
65-81KHPPTPKRRARKQPKPQ
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
Amino Acid Sequences MRRKGAAAPRFSRPLNTPESDDVPIHQLARSMLNLGPKGLSNYKADVNNCSPSTLVGTEHEGSAKHPPTPKRRARKQPKPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.41
3 0.4
4 0.37
5 0.35
6 0.38
7 0.36
8 0.32
9 0.28
10 0.25
11 0.23
12 0.2
13 0.16
14 0.14
15 0.12
16 0.14
17 0.13
18 0.12
19 0.12
20 0.15
21 0.15
22 0.14
23 0.14
24 0.12
25 0.15
26 0.14
27 0.15
28 0.13
29 0.14
30 0.17
31 0.2
32 0.21
33 0.22
34 0.24
35 0.27
36 0.26
37 0.25
38 0.21
39 0.18
40 0.2
41 0.16
42 0.14
43 0.11
44 0.15
45 0.15
46 0.15
47 0.15
48 0.13
49 0.14
50 0.21
51 0.22
52 0.22
53 0.28
54 0.36
55 0.45
56 0.56
57 0.64
58 0.67
59 0.77
60 0.84
61 0.89