Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3PRI5

Protein Details
Accession A0A0C3PRI5   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
7-32NACVDRPTATWRRKRKNGGCGVWKGRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 10.5, mito 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MAGAPRNACVDRPTATWRRKRKNGGCGVWKGRQAEPRLRQPHRQLTIPTPNKKQTKSNQPPYANQHTTITLCSHYKYKQGSLIPLRVQNPSYVQKPPPKGGTDHPAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.45
3 0.53
4 0.61
5 0.69
6 0.76
7 0.83
8 0.84
9 0.85
10 0.86
11 0.86
12 0.83
13 0.81
14 0.78
15 0.72
16 0.67
17 0.6
18 0.54
19 0.51
20 0.48
21 0.48
22 0.49
23 0.54
24 0.59
25 0.6
26 0.63
27 0.65
28 0.7
29 0.64
30 0.6
31 0.53
32 0.51
33 0.58
34 0.58
35 0.56
36 0.52
37 0.56
38 0.58
39 0.57
40 0.57
41 0.54
42 0.58
43 0.62
44 0.67
45 0.68
46 0.66
47 0.69
48 0.69
49 0.71
50 0.61
51 0.52
52 0.43
53 0.36
54 0.33
55 0.29
56 0.23
57 0.16
58 0.16
59 0.16
60 0.18
61 0.18
62 0.23
63 0.25
64 0.27
65 0.31
66 0.32
67 0.39
68 0.41
69 0.46
70 0.44
71 0.46
72 0.45
73 0.42
74 0.4
75 0.34
76 0.34
77 0.33
78 0.33
79 0.33
80 0.38
81 0.44
82 0.5
83 0.54
84 0.54
85 0.52
86 0.53
87 0.54