Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9D8M2

Protein Details
Accession E9D8M2   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
69-90KAQRIMPPRKPRRSNGRKAQPLHydrophilic
NLS Segment(s)
PositionSequence
75-86PPRKPRRSNGRK
Subcellular Location(s) mito 13, nucl 9, plas 2, extr 2
Family & Domain DBs
Amino Acid Sequences MLLPRRACPFISRSHHAISAFASPTTIPPLLLCFPCQAKALPRGLGLRFCCSGSRASKSQTVVCQGNLKAQRIMPPRKPRRSNGRKAQPLQQNDGDAHLLADGSRWRPGIGCPSRRQNADSYSGRYDSYQPGERQRRTNGDSWRPEMTRYTPPSNRNTAGNRSASSSQTDPYLQPKMLPPTRISRPQRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.5
3 0.46
4 0.42
5 0.35
6 0.32
7 0.27
8 0.23
9 0.19
10 0.16
11 0.17
12 0.2
13 0.18
14 0.13
15 0.12
16 0.16
17 0.19
18 0.2
19 0.2
20 0.18
21 0.2
22 0.22
23 0.23
24 0.21
25 0.23
26 0.28
27 0.31
28 0.29
29 0.3
30 0.32
31 0.32
32 0.37
33 0.33
34 0.3
35 0.28
36 0.27
37 0.25
38 0.22
39 0.26
40 0.25
41 0.28
42 0.27
43 0.29
44 0.33
45 0.35
46 0.37
47 0.35
48 0.35
49 0.31
50 0.29
51 0.31
52 0.27
53 0.32
54 0.32
55 0.31
56 0.27
57 0.27
58 0.33
59 0.36
60 0.43
61 0.45
62 0.52
63 0.6
64 0.69
65 0.73
66 0.74
67 0.77
68 0.8
69 0.81
70 0.81
71 0.81
72 0.8
73 0.77
74 0.78
75 0.74
76 0.67
77 0.61
78 0.52
79 0.42
80 0.34
81 0.32
82 0.24
83 0.16
84 0.13
85 0.08
86 0.06
87 0.04
88 0.05
89 0.05
90 0.06
91 0.08
92 0.08
93 0.08
94 0.09
95 0.1
96 0.2
97 0.26
98 0.31
99 0.35
100 0.43
101 0.47
102 0.48
103 0.48
104 0.42
105 0.38
106 0.4
107 0.38
108 0.35
109 0.33
110 0.33
111 0.31
112 0.28
113 0.27
114 0.23
115 0.26
116 0.27
117 0.27
118 0.37
119 0.46
120 0.49
121 0.52
122 0.54
123 0.56
124 0.54
125 0.58
126 0.57
127 0.58
128 0.59
129 0.58
130 0.58
131 0.51
132 0.48
133 0.45
134 0.41
135 0.4
136 0.41
137 0.46
138 0.46
139 0.51
140 0.56
141 0.59
142 0.56
143 0.54
144 0.53
145 0.52
146 0.52
147 0.5
148 0.44
149 0.43
150 0.43
151 0.38
152 0.38
153 0.32
154 0.26
155 0.25
156 0.27
157 0.23
158 0.26
159 0.3
160 0.25
161 0.26
162 0.32
163 0.39
164 0.42
165 0.43
166 0.41
167 0.45
168 0.53
169 0.61