Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3PEA6

Protein Details
Accession A0A0C3PEA6   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
115-143QKQVAKKVKVPRSPKKDKKKELKEEAPASBasic
NLS Segment(s)
PositionSequence
93-137KKEERPKSPGLISKLLSSIKEGQKQVAKKVKVPRSPKKDKKKELK
218-221KKKD
223-230SKALKVGR
Subcellular Location(s) cyto_nucl 12.833, cyto 12.5, nucl 12, mito_nucl 7.333
Family & Domain DBs
Amino Acid Sequences MSATEATVVAPTEEVKAVETSQEPAPTTEAPAEAPAQATEEVAAATEAPKEESKDAEPVTESAGEAPAEPATETAAAEPAKEEAKTDAAAEAKKEERPKSPGLISKLLSSIKEGQKQVAKKVKVPRSPKKDKKKELKEEAPASTEEAPKEEAAPEAKPAETSAEAPVVEEAPAEPVKETENAEPAPAEPAADAPAEAPAESSEAPKEDKVEEKAAEEKKKDDSKALKVGRRLSARVGDFFRPKKSEVSTPAKVDEHPPKIDEPTPLAPLENPAVPVATEQAPVEETAAPAEPAPAAAPVIAAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.13
4 0.13
5 0.15
6 0.15
7 0.17
8 0.18
9 0.21
10 0.2
11 0.2
12 0.23
13 0.21
14 0.22
15 0.21
16 0.18
17 0.16
18 0.17
19 0.17
20 0.14
21 0.14
22 0.12
23 0.12
24 0.12
25 0.11
26 0.1
27 0.09
28 0.08
29 0.07
30 0.07
31 0.05
32 0.06
33 0.07
34 0.07
35 0.09
36 0.11
37 0.13
38 0.15
39 0.17
40 0.19
41 0.23
42 0.23
43 0.22
44 0.22
45 0.2
46 0.21
47 0.19
48 0.16
49 0.12
50 0.13
51 0.11
52 0.1
53 0.1
54 0.08
55 0.08
56 0.08
57 0.07
58 0.07
59 0.07
60 0.07
61 0.06
62 0.1
63 0.09
64 0.09
65 0.1
66 0.1
67 0.11
68 0.11
69 0.11
70 0.1
71 0.11
72 0.12
73 0.12
74 0.12
75 0.14
76 0.14
77 0.14
78 0.16
79 0.17
80 0.2
81 0.26
82 0.27
83 0.3
84 0.34
85 0.37
86 0.38
87 0.41
88 0.43
89 0.43
90 0.44
91 0.39
92 0.35
93 0.35
94 0.32
95 0.27
96 0.24
97 0.26
98 0.27
99 0.32
100 0.31
101 0.32
102 0.36
103 0.38
104 0.44
105 0.44
106 0.41
107 0.41
108 0.5
109 0.55
110 0.58
111 0.66
112 0.67
113 0.69
114 0.79
115 0.83
116 0.85
117 0.86
118 0.88
119 0.9
120 0.9
121 0.9
122 0.89
123 0.86
124 0.82
125 0.76
126 0.67
127 0.57
128 0.47
129 0.38
130 0.31
131 0.25
132 0.18
133 0.14
134 0.14
135 0.12
136 0.12
137 0.11
138 0.09
139 0.09
140 0.09
141 0.09
142 0.09
143 0.09
144 0.09
145 0.09
146 0.09
147 0.09
148 0.09
149 0.09
150 0.09
151 0.09
152 0.09
153 0.09
154 0.08
155 0.07
156 0.06
157 0.05
158 0.06
159 0.07
160 0.07
161 0.07
162 0.07
163 0.08
164 0.1
165 0.12
166 0.1
167 0.13
168 0.13
169 0.14
170 0.13
171 0.12
172 0.13
173 0.11
174 0.09
175 0.06
176 0.06
177 0.07
178 0.07
179 0.07
180 0.05
181 0.06
182 0.06
183 0.06
184 0.06
185 0.05
186 0.07
187 0.07
188 0.08
189 0.08
190 0.09
191 0.1
192 0.11
193 0.12
194 0.12
195 0.17
196 0.19
197 0.23
198 0.22
199 0.23
200 0.3
201 0.35
202 0.39
203 0.36
204 0.35
205 0.39
206 0.44
207 0.43
208 0.44
209 0.44
210 0.45
211 0.54
212 0.59
213 0.55
214 0.55
215 0.6
216 0.59
217 0.57
218 0.51
219 0.46
220 0.46
221 0.43
222 0.42
223 0.4
224 0.39
225 0.43
226 0.45
227 0.47
228 0.43
229 0.43
230 0.43
231 0.43
232 0.45
233 0.46
234 0.51
235 0.5
236 0.5
237 0.52
238 0.48
239 0.45
240 0.45
241 0.46
242 0.43
243 0.39
244 0.39
245 0.37
246 0.4
247 0.42
248 0.37
249 0.34
250 0.32
251 0.33
252 0.31
253 0.29
254 0.25
255 0.25
256 0.25
257 0.2
258 0.17
259 0.15
260 0.15
261 0.14
262 0.14
263 0.14
264 0.13
265 0.13
266 0.12
267 0.13
268 0.13
269 0.13
270 0.14
271 0.12
272 0.11
273 0.11
274 0.12
275 0.11
276 0.11
277 0.11
278 0.09
279 0.09
280 0.09
281 0.08
282 0.08
283 0.07
284 0.07