Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7RYQ9

Protein Details
Accession R7RYQ9   
Localization Confidence High
Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
68-89EPPPVQPRPKPRPVKKTREEVQBasic
92-116DDEPPPIKPRPKPRPVKRAAREEEQBasic
NLS Segment(s)
PositionSequence
76-83PKPRPVKK
97-111PIKPRPKPRPVKRAA
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, cyto 2.5
Family & Domain DBs
KEGG psq:PUNSTDRAFT_139755  -  
Amino Acid Sequences MSEDEMPPVKARPQSRTISGGRNGNMEPTSRSRASGSSRPVHHRTLSPPPAAGPSRYLGALEQTDEDEPPPVQPRPKPRPVKKTREEVQTDDDEPPPIKPRPKPRPVKRAAREEEQMDDDEPPIVKPRSKPGPAKDLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.48
3 0.52
4 0.51
5 0.52
6 0.52
7 0.52
8 0.46
9 0.44
10 0.39
11 0.36
12 0.33
13 0.27
14 0.26
15 0.25
16 0.3
17 0.27
18 0.28
19 0.26
20 0.29
21 0.34
22 0.37
23 0.38
24 0.39
25 0.43
26 0.49
27 0.52
28 0.51
29 0.47
30 0.44
31 0.43
32 0.46
33 0.46
34 0.4
35 0.36
36 0.33
37 0.36
38 0.34
39 0.29
40 0.2
41 0.16
42 0.16
43 0.16
44 0.15
45 0.1
46 0.11
47 0.1
48 0.09
49 0.08
50 0.08
51 0.08
52 0.08
53 0.08
54 0.07
55 0.07
56 0.08
57 0.1
58 0.11
59 0.14
60 0.18
61 0.28
62 0.35
63 0.45
64 0.55
65 0.61
66 0.71
67 0.77
68 0.84
69 0.8
70 0.82
71 0.79
72 0.77
73 0.73
74 0.65
75 0.6
76 0.53
77 0.48
78 0.4
79 0.34
80 0.27
81 0.23
82 0.21
83 0.22
84 0.23
85 0.27
86 0.32
87 0.43
88 0.52
89 0.62
90 0.72
91 0.77
92 0.83
93 0.86
94 0.9
95 0.87
96 0.87
97 0.83
98 0.79
99 0.73
100 0.64
101 0.59
102 0.5
103 0.43
104 0.34
105 0.29
106 0.22
107 0.19
108 0.17
109 0.14
110 0.18
111 0.19
112 0.23
113 0.25
114 0.34
115 0.43
116 0.51
117 0.58
118 0.59