Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7S3L7

Protein Details
Accession R7S3L7    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
61-88APPPPSRLPRPPKRKEGTARSRRPCQPLHydrophilic
NLS Segment(s)
PositionSequence
48-135RRRRRGTFKTAALAPPPPSRLPRPPKRKEGTARSRRPCQPLLLPPAARRRPRGLFKSAAPAAPHPSRPPRPPVSEEGGAARSRRPRPP
148-183ANKGARHVRDSRARPSGPRTREDEGAARSRRPRPPL
195-227VKKGARLVQDGRARPSGPRTRKDGCEARSKRPR
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 5, extr 3
Family & Domain DBs
KEGG psq:PUNSTDRAFT_138795  -  
Amino Acid Sequences MHDAPCTPVLQPPNVRAGSTSSAIHRAKDGARLVQIGRTHPSSASNTRRRRRGTFKTAALAPPPPSRLPRPPKRKEGTARSRRPCQPLLLPPAARRRPRGLFKSAAPAAPHPSRPPRPPVSEEGGAARSRRPRPPLLVLPALPALQHANKGARHVRDSRARPSGPRTREDEGAARSRRPRPPLLIAPAFPALQHVKKGARLVQDGRARPSGPRTRKDGCEARSKRPRPPLLIAPALPGLQCAKKAARLVQTAAPAYPRPSGPSGFSVREDGCAARSRGPRLVVLLHHDIKFKLSNIDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.36
4 0.37
5 0.33
6 0.31
7 0.3
8 0.24
9 0.32
10 0.33
11 0.32
12 0.29
13 0.29
14 0.28
15 0.33
16 0.34
17 0.29
18 0.31
19 0.33
20 0.32
21 0.33
22 0.33
23 0.29
24 0.31
25 0.29
26 0.28
27 0.25
28 0.29
29 0.31
30 0.37
31 0.45
32 0.5
33 0.58
34 0.65
35 0.73
36 0.75
37 0.78
38 0.79
39 0.79
40 0.79
41 0.78
42 0.75
43 0.72
44 0.69
45 0.63
46 0.55
47 0.49
48 0.42
49 0.38
50 0.36
51 0.33
52 0.34
53 0.37
54 0.45
55 0.52
56 0.58
57 0.65
58 0.7
59 0.78
60 0.8
61 0.83
62 0.83
63 0.83
64 0.84
65 0.84
66 0.85
67 0.82
68 0.85
69 0.82
70 0.79
71 0.7
72 0.64
73 0.61
74 0.58
75 0.58
76 0.56
77 0.51
78 0.49
79 0.57
80 0.59
81 0.55
82 0.52
83 0.51
84 0.52
85 0.59
86 0.6
87 0.56
88 0.52
89 0.5
90 0.54
91 0.49
92 0.43
93 0.36
94 0.32
95 0.32
96 0.3
97 0.3
98 0.26
99 0.33
100 0.37
101 0.39
102 0.45
103 0.45
104 0.48
105 0.5
106 0.51
107 0.48
108 0.44
109 0.4
110 0.35
111 0.31
112 0.27
113 0.24
114 0.22
115 0.23
116 0.26
117 0.31
118 0.33
119 0.35
120 0.39
121 0.45
122 0.47
123 0.45
124 0.43
125 0.38
126 0.35
127 0.32
128 0.27
129 0.2
130 0.14
131 0.11
132 0.09
133 0.09
134 0.09
135 0.12
136 0.12
137 0.16
138 0.2
139 0.2
140 0.24
141 0.26
142 0.31
143 0.36
144 0.4
145 0.42
146 0.45
147 0.44
148 0.42
149 0.47
150 0.5
151 0.45
152 0.44
153 0.44
154 0.4
155 0.41
156 0.4
157 0.37
158 0.32
159 0.36
160 0.34
161 0.32
162 0.35
163 0.4
164 0.44
165 0.44
166 0.45
167 0.42
168 0.48
169 0.51
170 0.52
171 0.48
172 0.43
173 0.4
174 0.38
175 0.32
176 0.25
177 0.21
178 0.17
179 0.16
180 0.17
181 0.17
182 0.18
183 0.21
184 0.24
185 0.24
186 0.26
187 0.29
188 0.31
189 0.36
190 0.41
191 0.4
192 0.41
193 0.4
194 0.36
195 0.34
196 0.4
197 0.42
198 0.43
199 0.45
200 0.48
201 0.51
202 0.55
203 0.61
204 0.6
205 0.54
206 0.57
207 0.57
208 0.61
209 0.66
210 0.66
211 0.66
212 0.68
213 0.71
214 0.66
215 0.68
216 0.66
217 0.63
218 0.64
219 0.56
220 0.48
221 0.42
222 0.36
223 0.29
224 0.22
225 0.18
226 0.14
227 0.15
228 0.16
229 0.16
230 0.21
231 0.25
232 0.29
233 0.34
234 0.35
235 0.38
236 0.38
237 0.41
238 0.38
239 0.35
240 0.32
241 0.26
242 0.26
243 0.26
244 0.22
245 0.22
246 0.24
247 0.25
248 0.26
249 0.3
250 0.33
251 0.33
252 0.34
253 0.34
254 0.31
255 0.32
256 0.3
257 0.25
258 0.22
259 0.26
260 0.26
261 0.3
262 0.34
263 0.37
264 0.4
265 0.42
266 0.4
267 0.38
268 0.4
269 0.35
270 0.37
271 0.4
272 0.4
273 0.4
274 0.4
275 0.37
276 0.37
277 0.38
278 0.32