Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7S0S1

Protein Details
Accession R7S0S1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
89-110GVENLRPRESRKPQRGPVTREMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 5.5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010998  Integrase_recombinase_N  
Gene Ontology GO:0003677  F:DNA binding  
KEGG psq:PUNSTDRAFT_24805  -  
Amino Acid Sequences AIKASWAPNTLKGYSGAVDRYLRFCRQERIPSEERFPAPEVVLCAFAARALGRLAGGTARSWIAGLKAWHTAHDAPWLGGGRLQQVLKGVENLRPRESRKPQRGPVTREMLRQLHRKLRFESPLDTAVFAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.21
4 0.19
5 0.22
6 0.22
7 0.26
8 0.28
9 0.3
10 0.32
11 0.34
12 0.38
13 0.42
14 0.5
15 0.49
16 0.53
17 0.56
18 0.54
19 0.55
20 0.54
21 0.47
22 0.42
23 0.39
24 0.32
25 0.26
26 0.24
27 0.21
28 0.16
29 0.16
30 0.13
31 0.11
32 0.09
33 0.08
34 0.08
35 0.06
36 0.06
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.06
44 0.05
45 0.05
46 0.05
47 0.05
48 0.06
49 0.06
50 0.06
51 0.08
52 0.08
53 0.08
54 0.13
55 0.13
56 0.14
57 0.16
58 0.16
59 0.14
60 0.18
61 0.17
62 0.13
63 0.15
64 0.15
65 0.12
66 0.13
67 0.13
68 0.1
69 0.13
70 0.13
71 0.11
72 0.13
73 0.14
74 0.13
75 0.17
76 0.16
77 0.18
78 0.25
79 0.27
80 0.3
81 0.33
82 0.37
83 0.44
84 0.53
85 0.59
86 0.64
87 0.7
88 0.74
89 0.8
90 0.85
91 0.82
92 0.8
93 0.78
94 0.71
95 0.65
96 0.64
97 0.59
98 0.57
99 0.57
100 0.57
101 0.57
102 0.61
103 0.62
104 0.61
105 0.63
106 0.64
107 0.6
108 0.57
109 0.52
110 0.5
111 0.45
112 0.41