Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7S2Y0

Protein Details
Accession R7S2Y0   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
15-41RYNVWSWKRWKGSRKGGAKRHRKILRDBasic
NLS Segment(s)
PositionSequence
21-62WKRWKGSRKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKR
Subcellular Location(s) nucl 12, mito 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR001951  Histone_H4  
IPR019809  Histone_H4_CS  
IPR004823  TAF_TATA-bd_Histone-like_dom  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
KEGG psq:PUNSTDRAFT_93289  -  
Pfam View protein in Pfam  
PF02969  TAF  
PROSITE View protein in PROSITE  
PS00047  HISTONE_H4  
CDD cd00076  H4  
Amino Acid Sequences LVLRHRPPSSPKLARYNVWSWKRWKGSRKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDSVTYTEHAKRKTVTALDVVYALKRSGRTLYGFGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.63
3 0.63
4 0.62
5 0.6
6 0.59
7 0.55
8 0.6
9 0.66
10 0.67
11 0.69
12 0.69
13 0.73
14 0.77
15 0.82
16 0.83
17 0.83
18 0.86
19 0.87
20 0.83
21 0.83
22 0.81
23 0.75
24 0.74
25 0.75
26 0.75
27 0.72
28 0.68
29 0.61
30 0.57
31 0.53
32 0.45
33 0.37
34 0.3
35 0.23
36 0.23
37 0.28
38 0.26
39 0.3
40 0.34
41 0.4
42 0.41
43 0.48
44 0.48
45 0.49
46 0.51
47 0.47
48 0.42
49 0.36
50 0.31
51 0.24
52 0.22
53 0.16
54 0.13
55 0.13
56 0.12
57 0.11
58 0.1
59 0.1
60 0.09
61 0.07
62 0.06
63 0.07
64 0.07
65 0.09
66 0.1
67 0.1
68 0.12
69 0.12
70 0.12
71 0.1
72 0.11
73 0.1
74 0.1
75 0.12
76 0.15
77 0.21
78 0.27
79 0.28
80 0.3
81 0.31
82 0.32
83 0.37
84 0.35
85 0.3
86 0.3
87 0.29
88 0.26
89 0.27
90 0.24
91 0.19
92 0.18
93 0.16
94 0.14
95 0.14
96 0.16
97 0.18
98 0.21
99 0.23