Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R7S547

Protein Details
Accession R7S547    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
32-59YERPPSPAPSNKKPKRRPKPIEVDDDEHBasic
NLS Segment(s)
PositionSequence
39-50APSNKKPKRRPK
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
KEGG psq:PUNSTDRAFT_138225  -  
Amino Acid Sequences MANDLIDITVDNLDIKVECSEDSHPRYSSHEYERPPSPAPSNKKPKRRPKPIEVDDDEHGGVSAPPPAPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.07
4 0.08
5 0.08
6 0.1
7 0.13
8 0.19
9 0.23
10 0.25
11 0.26
12 0.26
13 0.31
14 0.34
15 0.35
16 0.35
17 0.37
18 0.35
19 0.38
20 0.4
21 0.38
22 0.35
23 0.32
24 0.3
25 0.32
26 0.38
27 0.43
28 0.52
29 0.57
30 0.66
31 0.75
32 0.82
33 0.85
34 0.89
35 0.88
36 0.87
37 0.91
38 0.87
39 0.87
40 0.81
41 0.75
42 0.65
43 0.59
44 0.48
45 0.37
46 0.29
47 0.2
48 0.14
49 0.1
50 0.13