Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7S3M4

Protein Details
Accession R7S3M4    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
13-33NRFIRFCRKEKIQRRFWLPADHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010998  Integrase_recombinase_N  
Gene Ontology GO:0003677  F:DNA binding  
KEGG psq:PUNSTDRAFT_20950  -  
Amino Acid Sequences APSTLQGYNSAVNRFIRFCRKEKIQRRFWLPADELVLCAFAASSKGRHAGSTVRNAIAGLKAWHAAQNAEWKGGKQLKYILNGVENQRPLSSRCPPCFPVSRNFLRILRAKLNLSNPVDIAVFAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.32
3 0.38
4 0.39
5 0.43
6 0.48
7 0.55
8 0.64
9 0.72
10 0.76
11 0.76
12 0.79
13 0.83
14 0.81
15 0.74
16 0.71
17 0.62
18 0.54
19 0.48
20 0.39
21 0.31
22 0.24
23 0.21
24 0.13
25 0.11
26 0.08
27 0.04
28 0.06
29 0.06
30 0.07
31 0.08
32 0.11
33 0.12
34 0.12
35 0.13
36 0.18
37 0.21
38 0.27
39 0.28
40 0.25
41 0.25
42 0.25
43 0.24
44 0.18
45 0.15
46 0.08
47 0.07
48 0.08
49 0.08
50 0.09
51 0.09
52 0.09
53 0.09
54 0.17
55 0.17
56 0.18
57 0.18
58 0.16
59 0.22
60 0.27
61 0.27
62 0.2
63 0.26
64 0.28
65 0.31
66 0.32
67 0.27
68 0.24
69 0.26
70 0.28
71 0.27
72 0.24
73 0.22
74 0.21
75 0.21
76 0.22
77 0.25
78 0.31
79 0.35
80 0.37
81 0.42
82 0.44
83 0.49
84 0.55
85 0.52
86 0.5
87 0.5
88 0.53
89 0.51
90 0.53
91 0.49
92 0.47
93 0.49
94 0.48
95 0.46
96 0.44
97 0.44
98 0.45
99 0.48
100 0.5
101 0.47
102 0.43
103 0.36
104 0.34
105 0.31
106 0.25