Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7S123

Protein Details
Accession R7S123   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
45-66INWKAFKSRKFWMRRERIYHYIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 24, mito 1, E.R. 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR032816  SNARE_assoc  
Gene Ontology GO:0016020  C:membrane  
KEGG psq:PUNSTDRAFT_138961  -  
Pfam View protein in Pfam  
PF09335  SNARE_assoc  
Amino Acid Sequences MSTGVEIIASPIPSIQQLEHARTVLTRTPSPSPTESEYLSRKTIINWKAFKSRKFWMRRERIYHYIAALIIIAIVGLFIAYQRKIVRALRPMSEWIKDRPAGWLIPIAVLFIVSFPPLLGHELIAILCGLVWGLGIGFGIVAAGTFIGELGNYYAFKYCCRTRAAKYETSTIPYACLTKIVRDGGFKIALISRYSIIPGHLTTAVYSTCGMSIGVFCAAAILSLPKQFLFIFVGVLVQNSDKGHGVPIKTRLISLAVVAVTIGITVGAGWYILREMNKVKDEIIYERRKSRQQYQATSRSNILAISTSSILDDTPKDDAVVGSDDIPMTPLRYRAHEHGAFDSRRENV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.18
4 0.23
5 0.28
6 0.31
7 0.3
8 0.3
9 0.29
10 0.33
11 0.3
12 0.3
13 0.28
14 0.3
15 0.35
16 0.38
17 0.42
18 0.41
19 0.4
20 0.4
21 0.4
22 0.38
23 0.38
24 0.41
25 0.39
26 0.38
27 0.35
28 0.31
29 0.32
30 0.39
31 0.4
32 0.44
33 0.45
34 0.48
35 0.57
36 0.62
37 0.62
38 0.58
39 0.6
40 0.61
41 0.65
42 0.7
43 0.71
44 0.75
45 0.81
46 0.83
47 0.81
48 0.79
49 0.73
50 0.65
51 0.55
52 0.46
53 0.36
54 0.28
55 0.2
56 0.13
57 0.09
58 0.06
59 0.05
60 0.03
61 0.02
62 0.02
63 0.02
64 0.02
65 0.03
66 0.06
67 0.06
68 0.09
69 0.1
70 0.12
71 0.17
72 0.22
73 0.28
74 0.33
75 0.37
76 0.37
77 0.39
78 0.42
79 0.41
80 0.41
81 0.37
82 0.33
83 0.35
84 0.33
85 0.31
86 0.29
87 0.29
88 0.24
89 0.22
90 0.21
91 0.16
92 0.16
93 0.15
94 0.12
95 0.09
96 0.09
97 0.08
98 0.05
99 0.05
100 0.04
101 0.04
102 0.04
103 0.04
104 0.05
105 0.07
106 0.07
107 0.06
108 0.07
109 0.07
110 0.07
111 0.07
112 0.06
113 0.04
114 0.03
115 0.03
116 0.03
117 0.02
118 0.02
119 0.02
120 0.02
121 0.02
122 0.02
123 0.02
124 0.02
125 0.02
126 0.02
127 0.02
128 0.02
129 0.02
130 0.02
131 0.02
132 0.02
133 0.02
134 0.02
135 0.02
136 0.02
137 0.03
138 0.04
139 0.04
140 0.05
141 0.08
142 0.08
143 0.09
144 0.14
145 0.15
146 0.19
147 0.23
148 0.26
149 0.28
150 0.38
151 0.43
152 0.44
153 0.44
154 0.45
155 0.42
156 0.41
157 0.38
158 0.28
159 0.23
160 0.17
161 0.16
162 0.11
163 0.13
164 0.1
165 0.11
166 0.14
167 0.15
168 0.15
169 0.15
170 0.17
171 0.16
172 0.16
173 0.14
174 0.13
175 0.12
176 0.13
177 0.12
178 0.12
179 0.1
180 0.1
181 0.1
182 0.1
183 0.09
184 0.09
185 0.08
186 0.09
187 0.09
188 0.09
189 0.09
190 0.1
191 0.09
192 0.08
193 0.08
194 0.07
195 0.06
196 0.06
197 0.06
198 0.05
199 0.05
200 0.05
201 0.05
202 0.05
203 0.04
204 0.04
205 0.04
206 0.04
207 0.04
208 0.04
209 0.05
210 0.07
211 0.07
212 0.07
213 0.08
214 0.08
215 0.1
216 0.11
217 0.1
218 0.09
219 0.09
220 0.1
221 0.09
222 0.09
223 0.08
224 0.06
225 0.08
226 0.07
227 0.09
228 0.08
229 0.08
230 0.12
231 0.14
232 0.16
233 0.18
234 0.24
235 0.27
236 0.27
237 0.27
238 0.24
239 0.23
240 0.22
241 0.18
242 0.15
243 0.1
244 0.09
245 0.09
246 0.08
247 0.06
248 0.05
249 0.05
250 0.02
251 0.02
252 0.02
253 0.02
254 0.02
255 0.02
256 0.02
257 0.03
258 0.04
259 0.06
260 0.07
261 0.09
262 0.13
263 0.19
264 0.22
265 0.23
266 0.23
267 0.24
268 0.26
269 0.31
270 0.37
271 0.4
272 0.42
273 0.49
274 0.54
275 0.58
276 0.62
277 0.65
278 0.65
279 0.66
280 0.71
281 0.74
282 0.79
283 0.77
284 0.73
285 0.65
286 0.57
287 0.48
288 0.37
289 0.29
290 0.2
291 0.15
292 0.15
293 0.14
294 0.12
295 0.12
296 0.12
297 0.11
298 0.11
299 0.12
300 0.11
301 0.13
302 0.13
303 0.13
304 0.14
305 0.14
306 0.14
307 0.16
308 0.14
309 0.12
310 0.13
311 0.13
312 0.12
313 0.14
314 0.12
315 0.11
316 0.13
317 0.17
318 0.19
319 0.24
320 0.3
321 0.34
322 0.43
323 0.45
324 0.46
325 0.48
326 0.55
327 0.51
328 0.48