Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7S043

Protein Details
Accession R7S043    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
18-40KTPWRLSTTRKANARKRLKQVDAHydrophilic
76-95FSKHEKSYRKGIHKVPKWTRBasic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG psq:PUNSTDRAFT_123207  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPSSICSVGLLWKTPWRLSTTRKANARKRLKQVDAVIEAVRASGVQCSALNRALELPKEHEMPARDKYTTFSKHEKSYRKGIHKVPKWTRLTLRTNPKGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.21
4 0.24
5 0.27
6 0.27
7 0.28
8 0.28
9 0.31
10 0.36
11 0.44
12 0.48
13 0.53
14 0.61
15 0.68
16 0.71
17 0.77
18 0.81
19 0.79
20 0.79
21 0.81
22 0.75
23 0.72
24 0.68
25 0.63
26 0.54
27 0.47
28 0.38
29 0.29
30 0.25
31 0.18
32 0.14
33 0.07
34 0.05
35 0.04
36 0.04
37 0.04
38 0.05
39 0.06
40 0.08
41 0.11
42 0.1
43 0.1
44 0.12
45 0.13
46 0.14
47 0.14
48 0.16
49 0.16
50 0.18
51 0.18
52 0.19
53 0.2
54 0.23
55 0.27
56 0.26
57 0.25
58 0.23
59 0.26
60 0.31
61 0.34
62 0.36
63 0.39
64 0.4
65 0.48
66 0.56
67 0.62
68 0.59
69 0.64
70 0.68
71 0.69
72 0.72
73 0.73
74 0.75
75 0.75
76 0.81
77 0.79
78 0.8
79 0.76
80 0.76
81 0.75
82 0.73
83 0.73
84 0.72
85 0.73