Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7S1W8

Protein Details
Accession R7S1W8    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-31FCESCVTCRRSKPNNQKPYGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12.166, nucl 10, cyto 10, cyto_mito 9.165, mito 6.5, cyto_pero 6.165
Family & Domain DBs
InterPro View protein in InterPro  
IPR001584  Integrase_cat-core  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
GO:0015074  P:DNA integration  
KEGG psq:PUNSTDRAFT_23472  -  
PROSITE View protein in PROSITE  
PS50994  INTEGRASE  
Amino Acid Sequences WWKSMVPDVRAFCESCVTCRRSKPNNQKPYGLLNPLPVPAQPWEAIGIDFVGPLPASKDRDSSYDEITVIIDLLSGRVHLVPSRQDYRARDIAELVFAEIYRLHGLPRRIVSDRDVLFTSTFWQHLNKMLGVKLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.34
4 0.34
5 0.37
6 0.44
7 0.53
8 0.55
9 0.65
10 0.71
11 0.74
12 0.81
13 0.8
14 0.77
15 0.7
16 0.7
17 0.64
18 0.57
19 0.48
20 0.4
21 0.37
22 0.34
23 0.31
24 0.22
25 0.19
26 0.15
27 0.16
28 0.13
29 0.12
30 0.13
31 0.13
32 0.13
33 0.11
34 0.09
35 0.07
36 0.07
37 0.06
38 0.05
39 0.04
40 0.04
41 0.06
42 0.08
43 0.11
44 0.12
45 0.14
46 0.15
47 0.18
48 0.21
49 0.21
50 0.2
51 0.19
52 0.18
53 0.16
54 0.15
55 0.13
56 0.09
57 0.06
58 0.05
59 0.03
60 0.04
61 0.03
62 0.03
63 0.04
64 0.04
65 0.04
66 0.05
67 0.07
68 0.1
69 0.16
70 0.19
71 0.22
72 0.26
73 0.29
74 0.35
75 0.39
76 0.36
77 0.32
78 0.3
79 0.28
80 0.24
81 0.22
82 0.15
83 0.1
84 0.08
85 0.08
86 0.07
87 0.08
88 0.08
89 0.08
90 0.09
91 0.14
92 0.16
93 0.21
94 0.24
95 0.28
96 0.29
97 0.31
98 0.33
99 0.37
100 0.36
101 0.34
102 0.32
103 0.28
104 0.26
105 0.24
106 0.25
107 0.19
108 0.18
109 0.17
110 0.18
111 0.18
112 0.24
113 0.28
114 0.27
115 0.27