FuNGI

R7S4Z3

Protein Details

Accession

R7S4Z3

Localization Confidence

Low

Confidence Score

8.2

NoLS Segment(s)

Position	Sequence	Protein Nature
11-41	QDALMTRKRKYDKAKICVKCKSKPGNAVFRH	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 11.5, cyto_nucl 10, cyto 7.5, mito 4, pero 3

Family & Domain DBs

InterPro	View protein in InterPro IPR019407 CTU2 IPR014729 Rossmann-like_a/b/a_fold
Gene Ontology	GO:0005737 C:cytoplasm GO:0016779 F:nucleotidyltransferase activity GO:0000049 F:tRNA binding GO:0032447 P:protein urmylation GO:0034227 P:tRNA thio-modification GO:0002098 P:tRNA wobble uridine modification
KEGG	psq:PUNSTDRAFT_107745 -
Pfam	View protein in Pfam PF10288 CTU2

Amino Acid Sequences

MTDCGNPAAEQDALMTRKRKYDKAKICVKCKSKPGNAVFRHAVYCKDCFVPHVWYKFGKALEPYINPGPHGPRKKSLNPTGNLCIGYSGGMGSTVLLDLVHRCYFAGRDAADDAEGEIGADGGARHPRHGRVWKHATVCFVDTGAAYGVAPDFQPQIKSVLSAYPEFEFIPISLEDAFDPAWWNSVHGDIPHNDLGIDINDEALPCVPTSSGSPRDRLNVFLNSMPTPTARMAMVSTLVRILLLYTAHSRGSSHLLLGNSSTSLSIGLISGIAQGGGFAINAELYEEWEPSEIVAKPQDSSVNVEGEHVAGAGHRRKARATWTGSVRMVRPLSDISMKECGMYSWWRNLNVLISDDIPMGRFVHEGSNVNKSIGGLTRDFIIGLERDYPSTVSTIARTCGKLAPKTQPGTLYRCCICERLSPPTVQDWKARISIRDLSNGKRSSRSSVHPAPGHSTPGNASISLADHVCYACHTACTSKSSKSGLSTAGAAAIHLPLWTRCHVDAMLRGCTTAPVKAAEALGDREEHREVWENKLMEREDMHALVQAFLLPEE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.25
2	0.29
3	0.29
4	0.38
5	0.44
6	0.51
7	0.55
8	0.63
9	0.68
10	0.74
11	0.81
12	0.82
13	0.85
14	0.86
15	0.84
16	0.8
17	0.8
18	0.81
19	0.79
20	0.8
21	0.8
22	0.8
23	0.77
24	0.77
25	0.71
26	0.63
27	0.59
28	0.5
29	0.47
30	0.4
31	0.38
32	0.33
33	0.32
34	0.29
35	0.28
36	0.3
37	0.33
38	0.37
39	0.39
40	0.39
41	0.38
42	0.41
43	0.43
44	0.41
45	0.36
46	0.31
47	0.33
48	0.36
49	0.36
50	0.38
51	0.39
52	0.39
53	0.36
54	0.37
55	0.39
56	0.42
57	0.5
58	0.49
59	0.51
60	0.59
61	0.67
62	0.73
63	0.75
64	0.75
65	0.71
66	0.72
67	0.69
68	0.64
69	0.56
70	0.45
71	0.36
72	0.26
73	0.22
74	0.15
75	0.1
76	0.06
77	0.06
78	0.06
79	0.05
80	0.05
81	0.04
82	0.04
83	0.04
84	0.05
85	0.06
86	0.1
87	0.11
88	0.11
89	0.11
90	0.12
91	0.13
92	0.15
93	0.18
94	0.14
95	0.16
96	0.17
97	0.18
98	0.17
99	0.16
100	0.13
101	0.09
102	0.09
103	0.06
104	0.05
105	0.04
106	0.04
107	0.04
108	0.04
109	0.06
110	0.12
111	0.13
112	0.16
113	0.19
114	0.23
115	0.31
116	0.41
117	0.44
118	0.48
119	0.56
120	0.6
121	0.61
122	0.6
123	0.55
124	0.48
125	0.44
126	0.34
127	0.26
128	0.2
129	0.15
130	0.14
131	0.11
132	0.08
133	0.06
134	0.06
135	0.06
136	0.06
137	0.06
138	0.06
139	0.07
140	0.08
141	0.09
142	0.1
143	0.12
144	0.12
145	0.13
146	0.13
147	0.14
148	0.15
149	0.15
150	0.16
151	0.14
152	0.15
153	0.14
154	0.14
155	0.11
156	0.09
157	0.11
158	0.09
159	0.09
160	0.08
161	0.09
162	0.08
163	0.09
164	0.09
165	0.06
166	0.08
167	0.07
168	0.09
169	0.09
170	0.1
171	0.09
172	0.11
173	0.11
174	0.11
175	0.14
176	0.12
177	0.17
178	0.17
179	0.16
180	0.14
181	0.14
182	0.13
183	0.11
184	0.11
185	0.06
186	0.06
187	0.07
188	0.07
189	0.07
190	0.07
191	0.06
192	0.05
193	0.05
194	0.05
195	0.05
196	0.08
197	0.13
198	0.22
199	0.23
200	0.25
201	0.26
202	0.31
203	0.31
204	0.32
205	0.3
206	0.24
207	0.24
208	0.24
209	0.25
210	0.21
211	0.21
212	0.18
213	0.14
214	0.13
215	0.12
216	0.11
217	0.09
218	0.09
219	0.09
220	0.08
221	0.1
222	0.08
223	0.08
224	0.07
225	0.07
226	0.06
227	0.06
228	0.05
229	0.04
230	0.04
231	0.05
232	0.07
233	0.08
234	0.09
235	0.09
236	0.09
237	0.1
238	0.14
239	0.13
240	0.12
241	0.14
242	0.14
243	0.14
244	0.14
245	0.12
246	0.08
247	0.08
248	0.07
249	0.05
250	0.05
251	0.04
252	0.04
253	0.04
254	0.04
255	0.03
256	0.03
257	0.03
258	0.03
259	0.03
260	0.03
261	0.02
262	0.03
263	0.03
264	0.02
265	0.02
266	0.02
267	0.02
268	0.02
269	0.03
270	0.03
271	0.04
272	0.05
273	0.05
274	0.05
275	0.06
276	0.06
277	0.05
278	0.09
279	0.07
280	0.08
281	0.1
282	0.1
283	0.1
284	0.11
285	0.13
286	0.1
287	0.14
288	0.15
289	0.14
290	0.14
291	0.14
292	0.13
293	0.12
294	0.11
295	0.07
296	0.05
297	0.04
298	0.08
299	0.11
300	0.16
301	0.17
302	0.18
303	0.19
304	0.22
305	0.27
306	0.31
307	0.33
308	0.35
309	0.37
310	0.41
311	0.42
312	0.42
313	0.37
314	0.34
315	0.29
316	0.23
317	0.2
318	0.16
319	0.17
320	0.19
321	0.18
322	0.16
323	0.19
324	0.19
325	0.17
326	0.17
327	0.15
328	0.13
329	0.17
330	0.16
331	0.2
332	0.23
333	0.24
334	0.24
335	0.25
336	0.25
337	0.21
338	0.21
339	0.14
340	0.12
341	0.12
342	0.12
343	0.11
344	0.1
345	0.09
346	0.08
347	0.08
348	0.07
349	0.07
350	0.1
351	0.12
352	0.15
353	0.16
354	0.22
355	0.22
356	0.22
357	0.21
358	0.19
359	0.18
360	0.18
361	0.19
362	0.13
363	0.13
364	0.14
365	0.13
366	0.13
367	0.12
368	0.1
369	0.08
370	0.09
371	0.11
372	0.11
373	0.11
374	0.12
375	0.12
376	0.11
377	0.11
378	0.11
379	0.09
380	0.11
381	0.12
382	0.14
383	0.17
384	0.17
385	0.18
386	0.21
387	0.25
388	0.28
389	0.31
390	0.38
391	0.42
392	0.44
393	0.44
394	0.46
395	0.45
396	0.47
397	0.46
398	0.43
399	0.37
400	0.38
401	0.37
402	0.33
403	0.31
404	0.33
405	0.33
406	0.36
407	0.37
408	0.35
409	0.36
410	0.42
411	0.45
412	0.4
413	0.41
414	0.36
415	0.36
416	0.41
417	0.42
418	0.34
419	0.34
420	0.39
421	0.36
422	0.42
423	0.42
424	0.41
425	0.47
426	0.5
427	0.47
428	0.45
429	0.45
430	0.44
431	0.46
432	0.47
433	0.47
434	0.51
435	0.56
436	0.53
437	0.54
438	0.51
439	0.48
440	0.48
441	0.39
442	0.32
443	0.25
444	0.27
445	0.26
446	0.2
447	0.19
448	0.14
449	0.15
450	0.15
451	0.14
452	0.1
453	0.1
454	0.1
455	0.1
456	0.1
457	0.11
458	0.1
459	0.12
460	0.13
461	0.15
462	0.18
463	0.24
464	0.26
465	0.27
466	0.31
467	0.34
468	0.35
469	0.35
470	0.36
471	0.32
472	0.31
473	0.28
474	0.23
475	0.22
476	0.19
477	0.15
478	0.13
479	0.11
480	0.09
481	0.08
482	0.09
483	0.09
484	0.12
485	0.15
486	0.18
487	0.18
488	0.21
489	0.22
490	0.25
491	0.29
492	0.31
493	0.34
494	0.3
495	0.3
496	0.27
497	0.3
498	0.27
499	0.23
500	0.21
501	0.17
502	0.18
503	0.2
504	0.2
505	0.19
506	0.2
507	0.2
508	0.19
509	0.2
510	0.19
511	0.21
512	0.23
513	0.21
514	0.22
515	0.29
516	0.3
517	0.35
518	0.41
519	0.38
520	0.38
521	0.45
522	0.42
523	0.35
524	0.35
525	0.31
526	0.29
527	0.28
528	0.27
529	0.24
530	0.23
531	0.21
532	0.2
533	0.17

R7S4Z3

3D AlphaFold-predicted Structure Viewer