Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7S300

Protein Details
Accession R7S300   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
37-68PPPKAKSSNGDWRKNKRTRKAYSCIPCHKRKVHydrophilic
NLS Segment(s)
PositionSequence
49-53RKNKR
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
KEGG psq:PUNSTDRAFT_55739  -  
Amino Acid Sequences MDVDQPSRPACASSPSSLAPSPHDEDQKPQLTDSNSPPPKAKSSNGDWRKNKRTRKAYSCIPCHKRKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.27
4 0.27
5 0.27
6 0.24
7 0.25
8 0.25
9 0.26
10 0.29
11 0.27
12 0.29
13 0.36
14 0.38
15 0.34
16 0.3
17 0.3
18 0.28
19 0.31
20 0.31
21 0.34
22 0.3
23 0.31
24 0.33
25 0.31
26 0.34
27 0.35
28 0.33
29 0.29
30 0.34
31 0.44
32 0.52
33 0.59
34 0.63
35 0.7
36 0.77
37 0.8
38 0.83
39 0.83
40 0.84
41 0.84
42 0.85
43 0.83
44 0.83
45 0.84
46 0.84
47 0.84
48 0.83