Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R7S080

Protein Details
Accession R7S080    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
20-42AMTNPRPTPHSVRPRQRCDRCDVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, cyto_mito 10, nucl 8
Family & Domain DBs
KEGG psq:PUNSTDRAFT_139364  -  
Amino Acid Sequences MATQLSQAQAAVRQTGHVYAMTNPRPTPHSVRPRQRCDRCDVVDAQNVQLLGVLDELSVFSPLCAYTTAGADPASSNSTRCTRCEMLDAQNGQLKEALNELNTLRAEIELLRHCNRTMKQQLERRQLLFMHEQVKELSELSVLVTSINQFAADM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.17
4 0.14
5 0.14
6 0.17
7 0.26
8 0.29
9 0.31
10 0.3
11 0.31
12 0.33
13 0.37
14 0.4
15 0.42
16 0.48
17 0.55
18 0.66
19 0.74
20 0.81
21 0.86
22 0.87
23 0.81
24 0.77
25 0.76
26 0.69
27 0.63
28 0.57
29 0.51
30 0.47
31 0.44
32 0.37
33 0.29
34 0.25
35 0.21
36 0.18
37 0.13
38 0.08
39 0.07
40 0.06
41 0.05
42 0.05
43 0.05
44 0.04
45 0.05
46 0.04
47 0.04
48 0.04
49 0.04
50 0.05
51 0.05
52 0.06
53 0.06
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07
59 0.06
60 0.07
61 0.08
62 0.07
63 0.08
64 0.1
65 0.15
66 0.16
67 0.17
68 0.22
69 0.22
70 0.23
71 0.26
72 0.27
73 0.26
74 0.31
75 0.3
76 0.26
77 0.27
78 0.26
79 0.22
80 0.21
81 0.16
82 0.11
83 0.12
84 0.11
85 0.09
86 0.1
87 0.1
88 0.12
89 0.12
90 0.12
91 0.1
92 0.09
93 0.1
94 0.09
95 0.13
96 0.14
97 0.19
98 0.21
99 0.23
100 0.24
101 0.3
102 0.31
103 0.36
104 0.41
105 0.44
106 0.51
107 0.58
108 0.68
109 0.71
110 0.74
111 0.66
112 0.61
113 0.53
114 0.49
115 0.45
116 0.4
117 0.36
118 0.32
119 0.31
120 0.28
121 0.29
122 0.25
123 0.2
124 0.16
125 0.1
126 0.09
127 0.09
128 0.1
129 0.08
130 0.08
131 0.08
132 0.09
133 0.09
134 0.09