Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3EU05

Protein Details
Accession A0A0C3EU05    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
58-79GKLARSRSLPPPKWDRRRAKRLBasic
NLS Segment(s)
PositionSequence
61-79ARSRSLPPPKWDRRRAKRL
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MFAMRCLEKSQRSVSSGQTASFYHPRMRLYECEKYSLALFARSAPHPTSIRIITSLHGKLARSRSLPPPKWDRRRAKRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.42
3 0.38
4 0.34
5 0.3
6 0.26
7 0.28
8 0.3
9 0.29
10 0.26
11 0.27
12 0.28
13 0.29
14 0.31
15 0.31
16 0.34
17 0.4
18 0.36
19 0.37
20 0.36
21 0.34
22 0.31
23 0.28
24 0.21
25 0.13
26 0.13
27 0.11
28 0.13
29 0.13
30 0.15
31 0.14
32 0.17
33 0.17
34 0.19
35 0.21
36 0.19
37 0.19
38 0.18
39 0.18
40 0.15
41 0.2
42 0.2
43 0.19
44 0.2
45 0.2
46 0.24
47 0.29
48 0.33
49 0.29
50 0.33
51 0.41
52 0.5
53 0.56
54 0.58
55 0.64
56 0.69
57 0.78
58 0.84
59 0.85